IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ keener-1997-1 Histones H3 and H4 are components of upstream activation factor required for the high-level transcription of yeast rDNA by RNA polymerase I. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom edman degradation edman degradation Keener J., Dodd JA., Lalo D., Nomura M. Chromatin - Epigenetic interactions resulting in chromatin modulation Cell extract purified by pulldown on a Nickel column, heparin sulphate, anti-Ha affinity chromatography, followed by a further heparin sulphate column. H3 was identified by N-terminal sequencing, H4 by western blot. A further p30 component could not be identified. mnomura@uci.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1997 h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A rrn5_yeast RNA polymerase I-specific transcription initiation factor RRN5 RRN5 L3165 L9606.3 YLR141W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEHQQLRKYVELYNKEVEEFYNGAASGRPAEFHPSKVHVKSIHEKAGTANAGVEISSVGVDWDSEEKNTFFWCLSRYSIHRVDEWRSLLPRKSAMEILGYYRLLRRASASARSRKAGDDGAPIAYEMSAEWVALETKLSETVMAITEGAAEVADEEGHCEGLIDYESWKRRWVAIYSHSRIAEIRPLPRHALPLSRSATQTLERCVSRYTRTLLWCTALAGMASRSVSARAAESRGHKSLPTVVTRRQVERALCTEARSRDLHVLPRRIVLTLRKWELDYPREGKLFRTKEMAHLFLQSQLSRRDAPPVHQDENQENQENQENQEQDNTASEGESEAERDEIDEADLFRSALHENQLLKWLSK rrn5-rrn9-1 Components of UAF identified by affinity chromatography 666611 N/A 666612 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 666613 unspecified role unspecified role neutral component neutral component N/A 666614 unspecified role unspecified role neutral component neutral component c-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Figs 1 and 2 P53437 (RRN9) and P38204 (RRN10) have been shown by genetic interaction to be present in this complex. The author observed proteins of the correct mol. wt. but made no further attempt to identify these proteins. Identity of H4 confirmed by anti-myc immunostaining