InnateDB InnateDB levy-2011-1 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as autoradiography autoradiography Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-5 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-8 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-2 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as ms participant Identification by mass spectrometry ms participant Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-3 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-4 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro protein array protein array predetermined predetermined participant predetermined Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-6 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-7 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-9 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-10 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-11 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity levy-2011-12 Lysine methylation of the NF-κB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-κB signaling. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as antibody detection identification by antibody antibody detection Levy D., Kuo AJ., Chang Y., Schaefer U., Kitson C., Cheung P., Espejo A., Zee BM., Liu CL., Tangsombatvisit S., Tennen RI., Kuo AY., Tanjing S., Cheung R., Chua KF., Utz PJ., Shi X., Prinjha RK., Lee K., Garcia BA., Bedford MT., Tarakhovsky A., Cheng X., Gozani O. Chromatin - Epigenetic interactions resulting in chromatin modulation ogozani@stanford.edu Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity setd7_human Histone-lysine N-methyltransferase SETD7 SETD7 KIAA1717 SET7 KMT7 SET9 Histone H3-K4 methyltransferase SETD7 SET domain-containing protein 7 SET7/9 Lysine N-methyltransferase 7 protein protein human Homo sapiens Human MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS setd6_human N-lysine methyltransferase SETD6 SETD6 SET domain-containing protein 6 protein protein human Homo sapiens Human MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLLALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS ehmt1_human Histone-lysine N-methyltransferase EHMT1 KMT1D Histone H3-K9 methyltransferase 5 Euchromatic histone-lysine N-methyltransferase 1 G9a-like protein 1 Lysine N-methyltransferase 1D EHMT1 EUHMTASE1 KIAA1876 GLP protein protein human Homo sapiens Human MAAADAEAVPARGEPQQDCCVKTELLGEETPMAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRARKTMPKSVVGLHAASKDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEEQESVDTGEEEEGGDESDLSSESSIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYMEVSLDSLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTPVPGQEKGSALEGRADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQASAAQEAQEDGLPDTSSAAAADPL tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS kpcz_human Protein kinase C zeta type PRKCZ PKC2 nPKC-zeta protein protein human Homo sapiens Human MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV rela-setd7 1132227 n/a 1132239 enzyme enzyme neutral component neutral component n/a 1132240 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false methylation methylation reaction methylation false false false Fig. S1C methylation of RelA rela-setd6-1 1132227 n/a 1132239 enzyme enzyme neutral component neutral component n/a 1132240 enzyme target enzyme target substrate substrate neutral component neutral component Q04207:p.Lys310Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false methylation methylation reaction methylation false false false Fig. S1C methylation of RelA setd6-setd6 1132227 n/a 1132241 enzyme target enzyme target substrate substrate neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132241 enzyme enzyme neutral component neutral component methylation methylation reaction methylation false false false Fig. 1A (top band) methylation of SETD6 ehmt1-rela-1 1132228 n/a 1132242 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132240 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Fig. 5B, 6B participant was detected with Ab to RelA(Lys310me1) or RelA(Lys310me2) setd6-rela 1132228 n/a 1132241 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132240 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. S8A participant was detected with Ab to RelA(Lys310me1) rela-tf65 1132229 n/a 1132243 unspecified role unspecified role bait bait n/a 1132242 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5E, 5F, 6C, S8C PKC-z rela-ehmt1 1132229 n/a 1132241 unspecified role unspecified role prey prey n/a 1132243 unspecified role unspecified role bait bait n/a 1132242 unspecified role unspecified role prey prey association association false false false Fig. 5E rela-setd6-4 1132230 n/a 1132241 enzyme enzyme neutral component neutral component n/a 1132240 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) methylation methylation reaction methylation false false false Fig. 1C, S2A mono-methylation of RelA (Lys310me1) rela-setd6-5 1132231 n/a 1132241 enzyme enzyme neutral component neutral component Q8TBK2:p.Tyr285Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1132240 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q04207:p.Lys310Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false methylation methylation reaction methylation false false false Fig. 1D mono-methylation of RelA (Lys310me1) ehmt1-rela 1132232 n/a 1132242 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1132240 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Fig. 5A interaction was only detected with RelA(Lys310me1) and not detected in RelA rela-ehmt1-1 1132233 n/a 1132240 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1132242 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range false 1132297 1132295 direct interaction direct interaction false false false Fig. 5C participant was detected with Ab to RelA(Lys310me1) or RelA(Lys310me2) interaction required the presence of SETD6 ehmt1-rela-3 1132234 n/a 1132242 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132240 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5D, S8B rela-ehmt1 1132235 n/a 1132242 unspecified role unspecified role prey prey n/a 1132243 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5G TNF ehmt1-rela-5 1132236 n/a 1132242 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind range range range range false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1132240 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1132236 1132236 Table 1, Fig. S18 interaction only occur when RelA is mono- or di-methylated at Lys310 pH 8.0, temp=25C prkcz-prkcz 1132237 n/a 1132244 enzyme enzyme neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false catalytic domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1132240 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false false false Fig. 6E phosphorylation of RelA (Ser311ph) rela-setd6-6 1132238 n/a 1132241 enzyme enzyme neutral component neutral component Q8TBK2:p.Tyr285Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false n/a 1132240 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false methylation methylation reaction methylation false false false Fig. S2B, S6 mono-methylation of RelA (Lys310me1)