IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-2004f-1 MSX1 cooperates with histone H1b for inhibition of transcription and myogenesis. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee H., Habas R., Abate-Shen C. Chromatin - Epigenetic interactions resulting in chromatin modulation 1A,1B, 1C, S2 abate@cabm.rutgers.edu Science (0036-8075) 2004 Only protein-protein interactions imex curation lee-2004f-2 MSX1 cooperates with histone H1b for inhibition of transcription and myogenesis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lee H., Habas R., Abate-Shen C. Chromatin - Epigenetic interactions resulting in chromatin modulation 1A,1B, 1C, S2 abate@cabm.rutgers.edu Science (0036-8075) 2004 Only protein-protein interactions imex curation h15_mouse Histone H1.5 H1-5 H1 VAR.5 H1b H1f5 Hist1h1b protein protein mouse Mus musculus Mouse MSETAPAETAAPAPVEKSPAKKKTTKKAGAAKRKATGPPVSELITKAVSASKERGGVSLPALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKTGAAKAKKPAGATPKKPKKTAGAKKTVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKAAKSPAKPKAVKSKASKPKVTKPKTAKPKAAKAKKAVSKKK msx1_mouse Homeobox protein MSX-1 Msx1 Hox7 Hox7.1 Msh homeobox 1-like protein Homeobox protein Hox-7 Hox-7.1 protein protein mouse Mus musculus Mouse MAPAAAMTSLPLGVKVEDSAFAKPAGGGVGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRAALPVAPVGLYTAHVGYSMYHLT msx1-h1 Interaction detected by Immunoprecipitation of FLAG tagged Msx1 358467 N/A 358469 unspecified role unspecified role prey prey N/A 358470 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false P43276 endogenous msx1-h1-1 Interaction detected by Immunoprecipitation of FLAG tagged Msx1 358467 N/A 358470 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 358469 unspecified role unspecified role prey prey c terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Some amount of V5 tagged H1A (P43275) was also observed. This interaction was also observed when H1b was n-terminally V5 tagged (fig S1) msx1-h1-2 Interaction detected by pull down 358468 N/A 358469 unspecified role unspecified role prey prey N/A 358470 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false P43276 purified