IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ katz-2004-1 FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Katz A., Oliva M., Mosquna A., Hakim O., Ohad N. Chromatin - Epigenetic interactions resulting in chromatin modulation Figure 8(d). nirohad@post.tau.ac.il Plant J. (0960-7412) 2004 katz-2004-2 FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Katz A., Oliva M., Mosquna A., Hakim O., Ohad N. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid assay. Figure 8(d). nirohad@post.tau.ac.il Plant J. (0960-7412) 2004 fie_arath Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM FIE FIS3 At3g20740 MOE17.5 Protein FERTILIZATION-INDEPENDENT SEED 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVETGICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASIHTNYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGASDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQEGKVYVWDLKSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK clf_arath Histone-lysine N-methyltransferase CLF CLF At2g23380 F26B6.3 ICU1 PIF1 PIF2 SDG1 SET1 Protein INCURVATA 1 Protein photoperiod insensitive flowering Protein SET DOMAIN GROUP 1 Polycomb group protein CURLY LEAF protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASEASPSSSATRSEPPKDSPAEERGPASKEVSEVIESLKKKLAADRCISIKKRIDENKKNLFAITQSFMRSSMERGGSCKDGSDLLVKRQRDSPGMKSGIDESNNNRYVEDGPASSGMVQGSSVPVKISLRPIKMPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIDDEEEKRDFLEPEDYIIRMTLEQLGLSDSVLAELASFLSRSTSEIKARHGVLMKEKEVSESGDNQAESSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIFPAEKPAPWCPPVDENLTCGANCYKTLLKSGRFPGYGTIEGKTGTSSDGAGTKTTPTKFSSKLNGRKPKTFPSESASSNEKCALETSDSENGLQQDTNSDKVSSSPKVKGSGRRVGRKRNKNRVAERVPRKTQKRQKKTEASDSDSIASGSCSPSDAKHKDNEDATSSSQKHVKSGNSGKSRKNGTPAEVSNNSVKDDVPVCQSNEVASELDAPGSDESLRKEEFMGETVSRGRLATNKLWRPLEKSLFDKGVEIFGMNSCLIARNLLSGFKSCWEVFQYMTCSENKASFFGGDGLNPDGSSKFDINGNMVNNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKRITEKKDQPCRQFNPCNCKIACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVIGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVSKHEYLGEYTGELISHKEADKRGKIYDRENCSFLFNLNDQFVLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKPEAPGSKKDENVTPSVGRPKKLA fie-clf-2 Interaction detected by GST pull down 104533 N/A 104535 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 104536 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false FIE was expressed in rabbit reticulocyte lysate and CLF-GST was expressed in E coli fie-clf Yeast 2 hybrid analysis reveals interaction between FIE protein and the CLF protein 104534 N/A 104535 unspecified role unspecified role bait bait N/A 104536 unspecified role unspecified role prey prey physical association physical association false false false