UniProt UniProt http://www.uniprot.org davie-2003-2 Tup1-Ssn6 interacts with multiple class I histone deacetylases in vivo. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Davie JK., Edmondson DG., Coco CB., Dent SY. Chromatin - Epigenetic interactions resulting in chromatin modulation syr@mdacct.tmc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation davie-2003-3 Tup1-Ssn6 interacts with multiple class I histone deacetylases in vivo. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Davie JK., Edmondson DG., Coco CB., Dent SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Yeast whole cell extracts (cells expressing HA-tagged RPD3 or HA-tagged HOS2) have been incubated with GST fusion proteins. syr@mdacct.tmc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation davie-2003-1 Tup1-Ssn6 interacts with multiple class I histone deacetylases in vivo. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Davie JK., Edmondson DG., Coco CB., Dent SY. Chromatin - Epigenetic interactions resulting in chromatin modulation syr@mdacct.tmc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation davie-2003-4 Tup1-Ssn6 interacts with multiple class I histone deacetylases in vivo. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Davie JK., Edmondson DG., Coco CB., Dent SY. Chromatin - Epigenetic interactions resulting in chromatin modulation Several CYC8 deletion constructs have been expressed in a CYC8-deleted strain. syr@mdacct.tmc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation cyc8_yeast General transcriptional corepressor CYC8 CYC8 CRT8 YBR112C YBR0908 SSN6 Glucose repression mediator protein CYC8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNPGGEQTIMEQPAQQQQQQQQQQQQQQQQAAVPQQPLDPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQLENPGNINKSNGAPTNASPAPPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQQHPAQQTPINSSATMYSNGASPQLQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQAQAQAQAQAQAQAQAQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQPLPRQQLQQKGVSVQMLNPQQGQPYITQPTVIQAHQLQPFSTQAMEHPQSSQLPPQQQQLQSVQHPQQLQGQPQAQAPQPLIQHNVEQNVLPQKRYMEGAIHTLVDAAVSSSTHTENNTKSPRQPTHAIPTQAPATGITNAEPQVKKQKLNSPNSNINKLVNTATSIEENAKSEVSNQSPAVVESNTNNTSQEEKPVKANSIPSVIGAQEPPQEASPAEEATKAASVSPSTKPLNTEPESSSVQPTVSSESSTTKANDQSTAETIELSTATVPAEASPVEDEVRQHSKEENGTTEASAPSTEEAEPAASRDAEKQQDETAATTITVIKPTLETMETVKEEAKMREEEQTSQEKSPQENTLPRENVVRQVEEDENYDD FC2D0D0C1B181207 hos2_yeast Probable histone deacetylase HOS2 G1330 YGL194C HOS2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGTFSYDVKTKENEPLFEFNSAYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHKIMDLYETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTLYTGASLDATRKLINNQSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHPRILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNGEFFPGTGDLTEIGCDKGKHFALNVPLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGLPMLVVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEDIPFRDSFGPDYSLYPMLDDLYENKNSKKLLEDIRIRCLENIRYLQGAPSVRMDAECIPTQDISALTEEEDKIIQEMNEETEADSSNRLEEMEKENSGLIAFS tup1_yeast General transcriptional corepressor TUP1 TUP1 AAR1 AER2 AMM1 CYC9 FLK1 SFL2 UMR7 YCR084C YCR84C Glucose repression regulatory protein TUP1 Flocculation suppressor protein Repressor AER2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTASVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIKHLKLGLEQRDHQIASLTVQQQRQQQQQQQVQQHLQQQQQQLAAASASVPVAQQPPATTSATATPAANTTTGSPSAFPVQASRPNLVGSQLPTTTLPVVSSNAQQQLPQQQLQQQQLQQQQPPPQVSVAPLSNTAINGSPTSKETTTLPSVKAPESTLKETEPENNNTSKINDTGSATTATTTTATETEIKPKEEDATPASLHQDHYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDDSAANNHRNSITENNTTTSTDNNTMTTTTTTTITTTAMTSAAELAKDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN 444104AAD63CB944 rpd3_yeast Histone deacetylase RPD3 RPD3 SDI2 YNL330C N0305 MOF6 REC3 SDS6 Transcriptional regulatory protein RPD3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDYKLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYAPSVQLNHTPRDAEDLGDVEEDSAEAKDTKGGSQYARDLHVEHDNEFY 34FFD72A7E7425DB hos1_yeast Histone deacetylase HOS1 YP9499.23C YPR068C HOS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKLVISTSIFQSQVADLLPCNNHQKSQLTYSLINAYDLLQHFDEVLTFPYARKDDLLEFHSKSYIDYLINGRFNKMMAQDVNNPMVESKWSELSELADNWNEKIDYNPSQDLQRFTTRENLYNYYLNHSQALENNMDCINNSEVPTNDKPTDTYILNSETKQYNLEGDCPIFSYLPMYCQVITGATLNLLDHLSPTERLIGINWDGGRHHAFKQRASGFCYINDVVLLIQRLRKAKLNKITYVDFDLHHGDGVEKAFQYSKQIQTISVHLYEPGFFPGTGSLSDSRKDKNVVNIPLKHGCDDNYLELIASKIVNPLIERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLLMSRFYTYLTWCVTKQFSNLRCGDNNSFQIDPFDVCDGDDSEQFIREHDLVEMYNEENYQYWIYEMEGSSRMKMLRNDNKDRDMVELMKFYEL 5DCFF35D8F6AC87D cyc8-hos2-1 546305 N/A 546309 unspecified role unspecified role bait bait N/A 546310 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C and 2C Interaction is independent of TUP1 as it was also demonstrated in a TUP1-deleted strain. cyc8-tup1-1 546305 N/A 546309 unspecified role unspecified role bait bait N/A 546311 unspecified role unspecified role prey prey physical association physical association false false false 1C cyc8-rpd3-1 546305 N/A 546309 unspecified role unspecified role bait bait N/A 546312 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Interaction is independent of TUP1 as it was also demonstrated in a TUP1-deleted strain. 2A tup1-rpd3-1 546305 N/A 546311 unspecified role unspecified role bait bait N/A 546312 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false A weak interaction was also demonstrated in a CYC8-deleted strain. 2B cyc8-rpd3-2 546306 N/A 546312 unspecified role unspecified role prey prey N/A 546309 unspecified role unspecified role bait bait n-terminus binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false certain certain sequence position certain certain certain sequence position certain false n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 3 cyc8-hos2-2 546306 N/A 546309 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 546312 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 tup1rpd3-1 546306 N/A 546312 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 546309 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 3 hos1-tup1-1 546307 N/A 546311 unspecified role unspecified role prey prey N/A 546313 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B hos1-cyc8-1 546307 N/A 546309 unspecified role unspecified role prey prey N/A 546313 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B cyc8-rpd3-3 546308 N/A 546312 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 546309 unspecified role unspecified role bait bait c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region TPR_REGION binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5 cyc8-hos2-3 546308 N/A 546310 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 546309 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5