IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hsu-2003-1 The yeast RSC chromatin-remodeling complex is required for kinetochore function in chromosome segregation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hsu JM., Huang J., Meluh PB., Laurent BC. Chromatin - Epigenetic interactions resulting in chromatin modulation 4B brehon.laurent@downstate.edu Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation hsu-2003-2 The yeast RSC chromatin-remodeling complex is required for kinetochore function in chromosome segregation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsu JM., Huang J., Meluh PB., Laurent BC. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid. 4B brehon.laurent@downstate.edu Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation hsu-2003-3 The yeast RSC chromatin-remodeling complex is required for kinetochore function in chromosome segregation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Hsu JM., Huang J., Meluh PB., Laurent BC. Chromatin - Epigenetic interactions resulting in chromatin modulation 4B brehon.laurent@downstate.edu Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation hsu-2003-4 The yeast RSC chromatin-remodeling complex is required for kinetochore function in chromosome segregation. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Hsu JM., Huang J., Meluh PB., Laurent BC. Chromatin - Epigenetic interactions resulting in chromatin modulation 4B brehon.laurent@downstate.edu Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation h2b1_yeast Histone H2B.1 HTB1 H2B1 SPT12 YDR224C YD9934.09C Suppressor of Ty protein 12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQA 9F5E9CFB341DB399 sth1_yeast Nuclear protein STH1/NPS1 STH1 NPS1 ATP-dependent helicase STH1 Chromatin structure-remodeling complex protein STH1 SNF2 homolog YIL126W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLQEQSELMSTVMNNTPTTVAALAAVAAASETNGKLGSEEQPEITIPKPRSSAQLEQLLYRYRAIQNHPKENKLEIKAIEDTFRNISRDQDIYETKLDTLRKSIDKGFQYDEDLLNKHLVALQLLEKDTDVPDYFLDLPDTKNDNTTAIEVDYSEKKPIKISADFNAKAKSLGLESKFSNATKTALGDPDTEIRISARISNRINELERLPANLGTYSLDDCLEFITKDDLSSRMDTFKIKALVELKSLKLLTKQKSIRQKLINNVASQAHHNIPYLRDSPFTAAAQRSVQIRSKVIVPQTVRLAEELERQQLLEKRKKERNLHLQKINSIIDFIKERQSEQWSRQERCFQFGRLGASLHNQMEKDEQKRIERTAKQRLAALKSNDEEAYLKLLDQTKDTRITQLLRQTNSFLDSLSEAVRAQQNEAKILHGEEVQPITDEEREKTDYYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESETNRDDDDKAELDDDELNDTLARSADEKILFDKIDKERMNQERADAKAQGLRVPPPRLIQLDELPKVFREDIEEHFKKEDSEPLGRIRQKKRVYYDDGLTEEQFLEAVEDDNMSLEDAIKKRREARERRRLRQNGTKENEIETLENTPEASETSLIENNSFTAAVDEETNADKETTASRSKRRSSRKKRTISIVTAEDKENTQEESTSQENGGAKVEEEVKSSSVEIINGSESKKKKPKLTVKIKLNKTTVLENNDGKRAEEKPESKSPAKKTAAKKTKTKSKSLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFTDEWFKEHSS 269A91BD853C20D0 h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 cenpa_yeast Histone H3-like centromeric protein CSE4 CSE4 Chromosome segregation protein 4 CENP-A homolog CSL2 YKL262 YKL049C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSKQQWVSSAIQSDSSGRSLSNVNRLAGDQQSINDRALSLLQRTRATKNLFPRREERRRYESSKSDLDIETDYEDQAGNLEIETENEEEAEMETEVPAPVRTHSYALDRYVRQKRREKQRKQSLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI 0170A10060EEC309 rsc58_yeast Chromatin structure-remodeling complex protein RSC58 Remodel the structure of chromatin complex subunit 58 RSC58 YLR033W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTESVGGNKLVDFLVNVQSILNAASVKCHVVDESFPAKFFEKNPDKIYESYCKFIKNRSNSEGLIRNEDKLVLTTINKRFENGEYEPIQGGFYKLYHDIKLVCTILIHFYPQGTRNYQLVDKFYKFSSELLLRECCRIGIALTQTNNIKSRSGKLLSGNEMDEYDDDDATELDKIISYDFIKISMNYTVPISQTYQIRTKDMDLFSSIISKSNLDKRPHELPNTNFKINNVLPQTDIENEAPRLGFVGANTSNIPDPTLPPTEMMTRFLHPNWYALPTTVWLKYGNYNSWAPSFNENGTVVDSTTRGLIWLERIGYMDLYEKNEKKVKQEELLNTNEEGINRKQNDENNKNVDGKSNGVQDDGGDNDNDATIASANSESTENKEQFIIKLQNLYNWTPSNYIGDDEIENFRNGTPDKLVSDSLLKLKRLRKERILNKVLKPTTEERELYFKVKRILKEVILAKKVSKVPINNVRAFPVLQTNYNGSIPVVRAQPGRKRKHKK sth1-htb1 360868 N/A 360872 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 360873 unspecified role unspecified role prey prey physical association physical association false false false Interaction independent of DNA. sth1-hht1 360868 N/A 360874 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 360873 unspecified role unspecified role prey prey physical association physical association false false false sth1-hhf1 360868 N/A 360873 unspecified role unspecified role prey prey N/A 360875 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sth1-cse4 360869 N/A 360876 unspecified role unspecified role prey prey N/A 360873 unspecified role unspecified role bait bait physical association physical association false false false sth1-rsc8 360869 N/A 360877 unspecified role unspecified role prey prey N/A 360873 unspecified role unspecified role bait bait physical association physical association false false false sth1-hht1-1 360870 N/A 360873 unspecified role unspecified role prey prey N/A 360874 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sth1-hhf1-1 360870 N/A 360875 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 360873 unspecified role unspecified role prey prey physical association physical association false false false sth1-hht1-2 360871 N/A 360873 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 360874 unspecified role unspecified role prey prey N/A 360875 unspecified role unspecified role prey prey N/A 360872 unspecified role unspecified role prey prey association association false false false Partially purified histones obtained by acid extraction of nucleus were used.