IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hsu-2000-2 Mitotic phosphorylation of histone H3 is governed by Ipl1/aurora kinase and Glc7/PP1 phosphatase in budding yeast and nematodes. in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay predetermined predetermined participant predetermined Hsu JY., Sun ZW., Li X., Reuben M., Tatchell K., Bishop DK., Grushcow JM., Brame CJ., Caldwell JA., Hunt DF., Lin R., Smith MM., Allis CD. Chromatin - Epigenetic interactions resulting in chromatin modulation Results were also verified by western blotting. Electrophoretic analysis of radiolabelled proteins Cell (0092-8674) 2000 hsu-2000-1 Mitotic phosphorylation of histone H3 is governed by Ipl1/aurora kinase and Glc7/PP1 phosphatase in budding yeast and nematodes. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Hsu JY., Sun ZW., Li X., Reuben M., Tatchell K., Bishop DK., Grushcow JM., Brame CJ., Caldwell JA., Hunt DF., Lin R., Smith MM., Allis CD. Chromatin - Epigenetic interactions resulting in chromatin modulation Cell (0092-8674) 2000 ipl1_yeast Spindle assembly checkpoint kinase IPL1 YPL209C Aurora kinase Increase-in-ploidy protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQRNSLVNIKLNANSPSKKTTTRPNTSRINKPWRISHSPQQRNPNSKIPSPVREKLNRLPVNNKKFLDMESSKIPSPIRKATSSKMIHENKKLPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWILRNKPFWENKRL h32_chick Histone H3.2 H3-I H3-II H3-III H3-IV H3-V H3-VI H3-VII H3-VIII Histone H3 class I protein protein chick Gallus gallus (Chicken) Chicken MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA h2b1_chick Histone H2B 1/2/3/4/6 H2B-IV H2B-VI H2B-I H2B-II H2B-III H2B VI H2B I H2B II H2B III H2B IV protein protein chick Gallus gallus (Chicken) Chicken MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA p16105-ipl1-2 Interaction indicated by kinase assay. 132204 N/A 132206 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 132207 enzyme target enzyme target substrate substrate unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation false false false IpL1 was his tagged. p02279-ipl1-1 Interaction indicated by kinase assay. 132204 N/A 132206 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 132208 enzyme target enzyme target substrate substrate unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation false false false IpL1 was his tagged. p16106-ipl1-1 Interaction indicated by kinase assay. 132205 N/A 132209 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 132206 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false H3 peptide 1-20 was used in the interaction. IpL1 was his tagged. S10 of H3 peptide phosphorylated.