bhf-ucl zhou-1998-2 Characterization of human FAST-1, a TGF beta and activin signal transducer. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Zhou S., Zawel L., Lengauer C., Kinzler K.W., Vogelstein B. Cardiac - Interactions involving cardiac related proteins GST-Smad2 (183-467aa) was synthesised in E. coli. Confirmed in Zawel et al...1998 (PMID: 9660945) vogelbe@welchlink.jhu.edu Mol. Cell (1097-2765) 1998 Only protein-protein interactions imex curation zhou-1998-1 Characterization of human FAST-1, a TGF beta and activin signal transducer. in vitro In vitro affinity techniques affinity technology affinity techniques autoradiography autoradiography Zhou S., Zawel L., Lengauer C., Kinzler K.W., Vogelstein B. Cardiac - Interactions involving cardiac related proteins Bait protein was directly bound to agarose beads to perform this experiment. GST-Smad2 (183-467aa) was synthesised in E. coli. Confirmed in Zawel et al...1998 (PMID: 9660945) vogelbe@welchlink.jhu.edu Mol. Cell (1097-2765) 1998 Only protein-protein interactions imex curation foxh1_human Forkhead box protein H1 FOXH1 FAST1 FAST2 Forkhead activin signal transducer 1 Forkhead activin signal transducer 2 protein protein human Homo sapiens Human MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL fbe FAST-1 binding element ss dna single stranded deoxyribonucleic acid ss DNA ss dna in vitro In vitro CGGATTGTGTATTGGCTGTAC are ARE oligonucleotide ss dna single stranded deoxyribonucleic acid ss DNA ss dna in vitro In vitro TATCTGCTGCCCTAAAATGTGTATTCCATGGAAATGTCTGCCCTTCTCTCCGTAC smad2_human Mothers against decapentaplegic homolog 2 SMAD2 MADH2 MADR2 Mad-related protein 2 SMAD family member 2 JV18-1 protein protein human Homo sapiens Human MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS fbe-foxh1 1572280 n/a 1572282 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false fh domain sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) n/a 1572283 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false synthetic construct synthetic construct direct interaction direct interaction false false false FIG. 4C are-foxh1 1572280 n/a 1572282 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1572284 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false synthetic construct synthetic construct direct interaction direct interaction false false false Fig. 4D smad2-foxh1 1572281 n/a 1572282 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sid domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1572285 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mh2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2B