IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ barhanin-1996-1 K(V)LQT1 and lsK (minK) proteins associate to form the I(Ks) cardiac potassium current. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Barhanin J., Lesage F., Guillemare E., Fink M., Lazdunski M., Romey G. Cardiac - Interactions involving cardiac related proteins douy@unice.fr Nature (0028-0836) 1996 imex curation Only protein-protein interactions kcne1_human Potassium voltage-gated channel subfamily E member 1 KCNE1 IKs producing slow voltage-gated potassium channel subunit beta Mink Minimal potassium channel Delayed rectifier potassium channel subunit IsK protein protein human Homo sapiens Human MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP mint kcnq1_mouse Potassium voltage-gated channel subfamily KQT member 1 Kcnq1 Kcna9 Kvlqt1 IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 KQT-like 1 Voltage-gated potassium channel subunit Kv7.1 protein protein mouse Mus musculus Mouse MDTASSPPSAERKRAGWSRLLGARRGSAVVKKCPFSLELAEGGPEGSTVYAPIAPTGAPGLAPPMSTPVSPAPAPADLGPRPRVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTGWKCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSATWKIYVRKPARSHTLLSPSPKPKKSVMVKKKKFKLDKDNGMSPGEKMFNVPHITYDPPEDRRPDHFSIDGYDSSVRKSPTLLEVSTPHFLRTNSFAEDLDLEGETLLTPITHVSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVIITDMLHQLLSMQQGGPTCNSRSQVVASNEGGSINPELFLPSNSLPTYEQLTVPQTGPDEGS kcnq1-kcne1-1 1574085 n/a 1574086 unspecified role unspecified role prey prey n/a 1574087 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 5b A stronger association of the glycosylated form of IsK to KvLQT1 is indicated by the enrichment of the IsK27K (glycosylated band) in the precipitate as compared to the 19K (unglycosylated) band.