bhf-ucl glerup-2014-1 SorCS2 regulates dopaminergic wiring and is processed into an apoptotic two-chain receptor in peripheral glia. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Glerup S., Olsen D., Vaegter C.B., Gustafsen C., Sjoegaard S.S., Hermey G., Kjolby M., Molgaard S., Ulrichsen M., Boggild S., Skeldal S., Fjorback A.N., Nyengaard J.R., Jacobsen J., Bender D., Bjarkam C.R., Sørensen E.S., Füchtbauer E.M., Eichele G., Madsen P., Willnow T.E., Petersen C.M., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The neurotrophic factor propeptides were expressed in E.coli using the Glutathione S-Transferase Gene Fusion System, but it was not specified if the GST tag was cleaved or not. The propeptide aa. ranges of NGFpro, BDNFpro and NT3pro were annotated in accordance to the UniProt sequence numbering which includes the signal peptide aa. The exact aa range of BDNFpro peptide is not clear. The authors did not reply to a request to clarify the above details. an@biokemi.au.dk, sg@biokemi.au.dk Neuron (0896-6273) 2014 Only protein-protein interactions imex curation glerup-2014-6 SorCS2 regulates dopaminergic wiring and is processed into an apoptotic two-chain receptor in peripheral glia. mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Glerup S., Olsen D., Vaegter C.B., Gustafsen C., Sjoegaard S.S., Hermey G., Kjolby M., Molgaard S., Ulrichsen M., Boggild S., Skeldal S., Fjorback A.N., Nyengaard J.R., Jacobsen J., Bender D., Bjarkam C.R., Sørensen E.S., Füchtbauer E.M., Eichele G., Madsen P., Willnow T.E., Petersen C.M., Nykjaer A. Cardiac - Interactions involving cardiac related proteins Sciatic nerve fibers. The neurotrophic factor propeptides were expressed in E.coli using the Glutathione S-Transferase Gene Fusion System, but it was not specified if the GST tag was cleaved or not. The propeptide aa. ranges of NGFpro, BDNFpro and NT3pro were annotated in accordance to the UniProt sequence numbering which includes the signal peptide aa. The exact aa range of BDNFpro peptide is not clear. The authors did not reply to a request to clarify the above details. an@biokemi.au.dk, sg@biokemi.au.dk Neuron (0896-6273) 2014 Only protein-protein interactions imex curation glerup-2014-3 SorCS2 regulates dopaminergic wiring and is processed into an apoptotic two-chain receptor in peripheral glia. mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Glerup S., Olsen D., Vaegter C.B., Gustafsen C., Sjoegaard S.S., Hermey G., Kjolby M., Molgaard S., Ulrichsen M., Boggild S., Skeldal S., Fjorback A.N., Nyengaard J.R., Jacobsen J., Bender D., Bjarkam C.R., Sørensen E.S., Füchtbauer E.M., Eichele G., Madsen P., Willnow T.E., Petersen C.M., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The neurotrophic factor propeptides were expressed in E.coli using the Glutathione S-Transferase Gene Fusion System, but it was not specified if the GST tag was cleaved or not. The propeptide aa. ranges of NGFpro, BDNFpro and NT3pro were annotated in accordance to the UniProt sequence numbering which includes the signal peptide aa. The exact aa range of BDNFpro peptide is not clear. The authors did not reply to a request to clarify the above details. an@biokemi.au.dk, sg@biokemi.au.dk Neuron (0896-6273) 2014 Only protein-protein interactions imex curation glerup-2014-4 SorCS2 regulates dopaminergic wiring and is processed into an apoptotic two-chain receptor in peripheral glia. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Glerup S., Olsen D., Vaegter C.B., Gustafsen C., Sjoegaard S.S., Hermey G., Kjolby M., Molgaard S., Ulrichsen M., Boggild S., Skeldal S., Fjorback A.N., Nyengaard J.R., Jacobsen J., Bender D., Bjarkam C.R., Sørensen E.S., Füchtbauer E.M., Eichele G., Madsen P., Willnow T.E., Petersen C.M., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The transfected cells were treated with dithiobis-succinimidylpropionate (DSP). After the treatment the cells were lysed and the proteins were co- immunoprecipitated with the corresponding antibodies. The neurotrophic factor propeptides were expressed in E.coli using the Glutathione S-Transferase Gene Fusion System, but it was not specified if the GST tag was cleaved or not. The propeptide aa. ranges of NGFpro, BDNFpro and NT3pro were annotated in accordance to the UniProt sequence numbering which includes the signal peptide aa. The exact aa range of BDNFpro peptide is not clear. The authors did not reply to a request to clarify the above details. an@biokemi.au.dk, sg@biokemi.au.dk Neuron (0896-6273) 2014 Only protein-protein interactions imex curation glerup-2014-5 SorCS2 regulates dopaminergic wiring and is processed into an apoptotic two-chain receptor in peripheral glia. mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Glerup S., Olsen D., Vaegter C.B., Gustafsen C., Sjoegaard S.S., Hermey G., Kjolby M., Molgaard S., Ulrichsen M., Boggild S., Skeldal S., Fjorback A.N., Nyengaard J.R., Jacobsen J., Bender D., Bjarkam C.R., Sørensen E.S., Füchtbauer E.M., Eichele G., Madsen P., Willnow T.E., Petersen C.M., Nykjaer A. Cardiac - Interactions involving cardiac related proteins Cerebellar granule neurons (CGN) prepared from P6 pups. The neurotrophic factor propeptides were expressed in E.coli using the Glutathione S-Transferase Gene Fusion System, but it was not specified if the GST tag was cleaved or not. The propeptide aa. ranges of NGFpro, BDNFpro and NT3pro were annotated in accordance to the UniProt sequence numbering which includes the signal peptide aa. The exact aa range of BDNFpro peptide is not clear. The authors did not reply to a request to clarify the above details. an@biokemi.au.dk, sg@biokemi.au.dk Neuron (0896-6273) 2014 Only protein-protein interactions imex curation glerup-2014-7 SorCS2 regulates dopaminergic wiring and is processed into an apoptotic two-chain receptor in peripheral glia. mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Glerup S., Olsen D., Vaegter C.B., Gustafsen C., Sjoegaard S.S., Hermey G., Kjolby M., Molgaard S., Ulrichsen M., Boggild S., Skeldal S., Fjorback A.N., Nyengaard J.R., Jacobsen J., Bender D., Bjarkam C.R., Sørensen E.S., Füchtbauer E.M., Eichele G., Madsen P., Willnow T.E., Petersen C.M., Nykjaer A. Cardiac - Interactions involving cardiac related proteins Sciatic nerve fibers. The neurotrophic factor propeptides were expressed in E.coli using the Glutathione S-Transferase Gene Fusion System, but it was not specified if the GST tag was cleaved or not. The propeptide aa. ranges of NGFpro, BDNFpro and NT3pro were annotated in accordance to the UniProt sequence numbering which includes the signal peptide aa. The exact aa range of BDNFpro peptide is not clear. The authors did not reply to a request to clarify the above details. an@biokemi.au.dk, sg@biokemi.au.dk Neuron (0896-6273) 2014 Only protein-protein interactions imex curation ngf_mouse Beta-nerve growth factor Ngf Ngfb protein protein mouse Mus musculus Mouse MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG sorc2_human VPS10 domain-containing receptor SorCS2 SORCS2 KIAA1329 protein protein human Homo sapiens Human MAHRGPSRASKGPGPTARAPSPGAPPPPRSPRSRPLLLLLLLLGACGAAGRSPEPGRLGPHAQLTRVPRSPPAGRAEPGGGEDRQARGTEPGAPGPSPGPAPGPGEDGAPAAGYRRWERAAPLAGVASRAQVSLISTSFVLKGDATHNQAMVHWTGENSSVILILTKYYHADMGKVLESSLWRSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQKQPIPFFVETLIFHPKEEDKVLAYTKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSGVDADPDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFFKATSANQTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGVRYALVLQDVRSSRQAEESVLIDILEVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYLRPPSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFGHISFRSDWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSSSSESSTNKCSANFWFNPLSPPDDCALGQTYTSSLGYRKVVSNVCEGGVDMQQSQVQLQCPLTPPRGLQVSIQGEAVAVRPGEDVLFVVRQEQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHRYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVLLPLNPNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGGGGGYWAVVVLFVIGLFAAGAFILYKFKRKRPGRTVYAQMHNEKEQEMTSPVSHSEDVQGAVQGNHSGVVLSINSREMHSYLVS p01138-pro_0000019599 NGF NGFB protein protein human Homo sapiens Human EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKR 19 121 p01139-pro_0000019602 Beta-nerve growth factor Ngf Ngfb protein protein mouse Mus musculus Mouse SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG 122 241 bdnf_human Brain-derived neurotrophic factor Abrineurin BDNF protein protein human Homo sapiens Human MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR ntf3_human Neurotrophin-3 Neurotrophic factor HDNF Nerve growth factor 2 NTF3 protein protein human Homo sapiens Human MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT tnr16_human Tumor necrosis factor receptor superfamily member 16 NGFR TNFRSF16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein human Homo sapiens Human MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSESTATSPV tnr16_mouse Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low affinity neurotrophin receptor p75NTR Low-affinity nerve growth factor receptor protein protein mouse Mus musculus Mouse MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDEETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMGSSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV sorc2_mouse VPS10 domain-containing receptor SorCS2 Sorcs2 protein protein mouse Mus musculus Mouse MAHRGPPSAPKRPGPTAPDRSFQALLPPCWPRSWPLLLLLLVLVAACGAMGRSPQPGRQGPGVQITRLLPAGRTESGDRKDPQARESEPSVPGLGPGSASGPSTDGAPAPGKGRRARAVPVAGAASASRAQVSLISTSFVLKGDATHNQAMVHWTGENSSVILILTKYYHADMGKVLESSLWRSSDFGTTYTKLTLQPGVTTVIDNFYICPANKRKIILVSSSLGDREQSLFLSTDEGATFQKYPVPFLVEMLLFHPKEEDKVLAYTKDSKLYVSSDLGKKWTLLQERVTKDHVFWAVSGVDDDPNLVHVEAQDLSGGYRYYTCLIYNCSAQPHIAPFSGPIDRGSLTVQDEYIFLKATSTNRTKYYVSYRRSDFVLMKLPKYALPKDLQIISTDEQQVFVAVQEWNQVDTYNLYQSDLRGVRYSLVLENVRSSRQAEENVVIDILEVRGVKGVFLANQKVDGKVTTVITYNKGRDWDYLRPPSTDMNGKPTNCQPPDCYLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHTWRQVFEEEHHVLYLDHGGVIAAIKDTSIPLKILKFSVDEGHTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFGHISFRSDWELVKVDFRPSFPRQCGEDDYSSWDLTDLQGDHCIMGQQRSYRKRKSTSWCVKGRSFTSALTSRVCKCRDSDFLCDYGFERSSSSESTANKCSANFWFNPLSPPEDCVLGQTYTSSLGYRKVVSNVCEGGVDLQQSPVQLQCPLQAPRGLQVSIRGEAVAVRPREDVLFVVRQEQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHHYESPGIYRVSVRAENMAGHDEAVLFVQVNSPLQALYLEVVPVIGVNQEVNLTAVLLPLNPNLTVFYWWIGHSLQPLLSLDNSVTTKFTDAGDVRVTVQAACGNSVLQDSRLVRVLDQFQVVPLRFSRELDTFNPNTPEWREDVGLVVTRLLSKETSIPEELLVTVVKPGLPTIADLYVLLPLPRPTRKRSLTSDKRLAAVQQALNSHRISFILRGGLRILVELRDTDTGPQRPGGSGGYWAVVVLFVIGLFAVGAFILYKFKRKRPGRTVYAQMHNEKEQEMTSPVSHSEDAQSTMQGNHSGVVLSINSREMHSYLVG bdnf_mouse Brain-derived neurotrophic factor Bdnf protein protein mouse Mus musculus Mouse MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV sorcs2-ngf-4 1569992 n/a 1569998 unspecified role unspecified role prey prey pro-ngf sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1569999 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1569992 Fig. 3A sorcs2-ngf-13 1569992 n/a 1570000 unspecified role unspecified role prey prey purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1569999 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 3B sorcs2-ngf-9 1569992 n/a 1570001 unspecified role unspecified role prey prey n/a 1569999 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1569992 Fig. 3A The mature form of NFG binds weakly as compared to the pro NGF sorcs2-bdnf-1 1569992 n/a 1570002 unspecified role unspecified role prey prey purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pro domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false ecoli Escherichia coli (strain K12) n/a 1569999 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 3B sorcs2-ntf3-1 1569992 n/a 1570003 unspecified role unspecified role prey prey purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pro domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1569999 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 3B sorcs2-ngfr-3 1569992 n/a 1570004 unspecified role unspecified role prey prey c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 1569999 unspecified role unspecified role bait bait ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 3G ngfr-sorcs2-4 1569993 n/a 1570005 unspecified role unspecified role neutral component neutral component n/a 1570006 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 7F ngf-sorcs2-1 1569993 n/a 1569998 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1570006 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 7F bdnf-sorcs2 1569993 n/a 1570007 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1570006 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 7F sorcs2-ngfr-2 1569994 n/a 1570006 unspecified role unspecified role bait bait n/a 1570005 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3E ngfr-sorcs2-1 1569995 n/a 1570008 unspecified role unspecified role neutral component neutral component n/a 1569999 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fg. 3D, 3F ngfr-sorcs2-2 1569996 n/a 1570005 unspecified role unspecified role neutral component neutral component n/a 1570006 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 4C ngfr-sorcs2-5 1569997 n/a 1570006 unspecified role unspecified role unspecified role unspecified role n/a 1570005 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 7G SorCS2 and p75NTR located in proximity in injured but not in uninjured sciatic nerve fibers.