IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2014g-5 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins The identity of "Glc-6-Pase" was determined by blatting primers - for mouse, in this publication, and for human, using those given in Ref. 17. tsopp@ucmail.uc.edu J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. li-2014g-1 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu rat liver cDNA library J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. li-2014g-2 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. li-2014g-3 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. li-2014g-4 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. g6pc_human_gene Glucose-6-phosphatase gene gene gene human Homo sapiens Human nr1d1_human Nuclear receptor subfamily 1 group D member 1 NR1D1 EAR1 HREV THRAL Rev-erbA-alpha V-erbA-related protein 1 protein protein human Homo sapiens Human MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ apoa4_human Apolipoprotein A-IV APOA4 Apolipoprotein A4 protein protein human Homo sapiens Human MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES nr1d1_rat Nuclear receptor subfamily 1 group D member 1 Nr1d1 Rev-erbA-alpha V-erbA-related protein 1 protein protein rat Rattus norvegicus (Rat) Rat MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGTVPPSLSDDSSPSSASSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKGTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQNAMNLANNQLSSLCPLETSPAPHPTSGSVGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGTSPGNFNANHASGSPPATTPQCWESQGCPSTPNDNNLLAAQRHNEALNGLRQGPSSYPPTWPSGPAHHSCHQPNSNGHRLCPTHVYSAPEGKAPANGLRQGNTKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQKTLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ apoa4_rat Apolipoprotein A-IV Apoa4 Apolipoprotein A4 protein protein rat Rattus norvegicus (Rat) Rat MFLKAVVLTVALVAITGTQAEVTSDQVANVMWDYFTQLSNNAKEAVEQLQKTDVTQQLNTLFQDKLGNINTYADDLQNKLVPFAVQLSGHLTKETERVREEIQKELEDLRANMMPHANKVSQMFGDNVQKLQEHLRPYATDLQAQINAQTQDMKRQLTPYIQRMQTTIQDNVENLQSSMVPFANELKEKFNQNMEGLKGQLTPRANELKATIDQNLEDLRSRLAPLAEGVQEKLNHQMEGLAFQMKKNAEELQTKVSTNIDQLQKNLAPLVEDVQSKLKGNTEGLQKSLEDLNKQLDQQVEVFRRAVEPLGDKFNMALVQQMEKFRQQLGSDSGDVESHLSFLEKNLREKVSSFMSTLQKKGSPDQPLALPLPEQVQEQVQEQVQPKPLES apoa4-g6pc 1572316 n/a 1572321 unspecified role unspecified role prey prey retinoid-related_orphan_receptor_alpha_response_element_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1572322 unspecified role unspecified role prey prey association association false false false 5A P06727 and P20393 decreases expression at RNA level of ENSG00000131482. P20393 decreases expression at RNA level of ENSG00000131482. P20393 is required for P06727 to decrease expression at RNA level of ENSG00000131482 and ENSG00000100889. P06727 increases expression at RNA level of ENSG00000126368. P06727 increases expression at protein level of ENSG00000126368. apoa4-g6pc-1 1572316 n/a 1572323 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1572321 unspecified role unspecified role prey prey retinoid-related_orphan_receptor_alpha_response_element_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5A P06727 decreases expression at RNA level of ENSG00000131482. P06727 decreases expression at RNA level of ENSG00000100889. P06727 and P20393 decreases expression at RNA level of ENSG00000131482. P06727 increases expression at RNA level of ENSG00000126368. P06727 increases expression at protein level of ENSG00000126368. apoa4-nr1d1 1572317 n/a 1572324 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1572325 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1572340 1572338 physical association physical association false false false No figure apoa4-nr1d1-1 1572318 n/a 1572323 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1572322 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4A apoa4-nr1d1-2 1572319 n/a 1572323 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1572322 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 4B apoa4-nr1d1-4 1572320 n/a 1572323 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1572322 unspecified role unspecified role prey prey physical association physical association false false false 5A