IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ uys-2010-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins A '26S proteasome subunit' was also identified as an interactor with MMGL isoform 4 Bait, but the exact protein found is not stated. hm@sun.ac.za human MATCHMAKER™ cardiac cDNA library BMC cell biology 2010 imex curation The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. Only protein-protein interactions imex curation uys-2010-2 rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts fluorescence imaging fluorescence microscopy fluorescence imaging tag visualisation tag visualisation Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za BMC cell biology 2010 imex curation Only protein-protein interactions imex curation uys-2010-6 rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za BMC cell biology 2010 imex curation Only protein-protein interactions imex curation uys-2010-7 rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za BMC cell biology 2010 Only protein-protein interactions imex curation imex curation uys-2010-4 rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za BMC cell biology 2010 imex curation Only protein-protein interactions imex curation uys-2010-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins hm@sun.ac.za BMC cell biology 2010 imex curation The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. Only protein-protein interactions imex curation uys-2010-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Uys GM., Ramburan A., Loos B., Kinnear CJ., Korkie LJ., Mouton J., Riedemann J., Moolman-Smook JC. Cardiac - Interactions involving cardiac related proteins The construct encoding MYBPC3 (domains C1-C2) has been entered as being of Human origin as previous work of the donor -Prof Hugh Watkins- has been with the human protein. Reference 1: Gautel et al., -1995 (pmid:7744002) describes the three phosphorylation sites in the Human MYBPC motif. Myomegalin -isoform 4- has also been entered as Human in origin, as the Mouse and Rat proteins do not have four isoforms. This protein has been entered as UniProt isoform 11 (Q5VU43-11) as it is here described as the "shortest" form of Myomegalin. This protein has an identical sequence to a protein with RefSeq identifier NP_001002810.1 - myomegalin isoform 4. hm@sun.ac.za BMC cell biology 2010 imex curation Only protein-protein interactions imex curation mypc3_human Myosin-binding protein C, cardiac-type C-protein, cardiac muscle isoform MYBPC3 protein protein human Homo sapiens Human MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ q5vu43-11 Myomegalin Cardiomyopathy-associated protein 2 Phosphodiesterase 4D-interacting protein PDE4DIP CMYA2 KIAA0454 KIAA0477 MMGL protein protein human Homo sapiens Human MSNGYRTLSQHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDK actc_human Actin, alpha cardiac muscle 1 ACTC1 ACTC Alpha-cardiac actin protein protein human Homo sapiens Human MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF myzap_human Myocardial zonula adherens protein MYZAP GRINL1A upstream protein MYOZAP protein protein human Homo sapiens Human MLRSTSTVTLLSGGAARTPGAPSRRANVCRLRLTVPPESPVPEQCEKKIERKEQLLDLSNGEPTRKLPQGVVYGVVRRSDQNQQKEMVVYGWSTSQLKEEMNYIKDVRATLEKVRKRMYGDYDEMRQKIRQLTQELSVSHAQQEYLENHIQTQSSALDRFNAMNSALASDSIGLQKTLVDVTLENSNIKDQIRNLQQTYEASMDKLREKQRQLEVAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEKEALLEETNSFLKAIEEANKKMQAAEISLEEKDQRIGELDRLIERMEKERHQLQLQLLEHETEMSGELTDSDKERYQQLEEASASLRERIRHLDDMVHCQQKKVKQMVEEIESLKKKLQQKQLLILQLLEKISFLEGENNELQSRLDYLTETQAKTEVETREIGVGCDLLPSQTGRTREIVMPSRNYTPYTRVLELTMKKTLT mint homomint flnc_human Filamin-C Filamin-2 Actin-binding-like protein ABP-L ABP-280-like protein Gamma-filamin FLNC ABPL FLN2 protein protein human Homo sapiens Human MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDLQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPHEEEPSEVPQLRQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP cnn1_human Calponin-1 CNN1 Basic calponin Calponin H1, smooth muscle protein protein human Homo sapiens Human MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA pard3_human Partitioning defective 3 homolog PARD3 PAR3 PAR3A Atypical PKC isotype-specific-interacting protein CTCL tumor antigen se2-5 PAR3-alpha protein protein human Homo sapiens Human MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSRLPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYSSYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS tcph_human T-complex protein 1 subunit eta CCT7 CCTH NIP7-1 CCT-eta HIV-1 Nef-interacting protein protein protein human Homo sapiens Human MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH svil_human Supervillin Archvillin p205/p250 SVIL protein protein human Homo sapiens Human MKRKERIARRLEGIENDTQPILLQSCTGLVTHRLLEEDTPRYMRASDPASPHIGRSNEEEETSDSSLEKQTRSKYCTETSGVHGDSPYGSGTMDTHSLESKAERIARYKAERRRQLAEKYGLTLDPEADSEYLSRYTKSRKEPDAVEKRGGKSDKQEESSRDASSLYPGTETMGLRTCAGESKDYALHVGDGSSDPEVLLNIENQRRGQELSATRQAHDLSPAAESSSTFSFSGRDSSFTEVPRSPKHAHSSSLQQAASRSPSFGDPQLSPEARPSTGKPKHEWFLQKDSEGDTPSLINWPSRVKVREKLVKEESARNSPELASESVTQRRHQPAPVHYVSFQSEHSAFDRVPSKAAGSTRQPIRGYVQPADTGHTAKLVTPETPENASECSWVASATQNVPKPPSLTVLEGDGRDSPVLHVCESKAEEEEGEGEGEEKEEDVCFTEALEQSKKTLLALEGDGLVRSPEDPSRNEDFGKPAVSTVTLEHQKELENVAQPPQAPHQPTERTGRSEMVLYIQSEPVSQDAKPTGHNREASKKRKVRTRSLSDFTGPPQLQALKYKDPASRRELELPSSKTEGPYGEISMLDTKVSVAQLRSAFLASANACRRPELKSRVERSAEGPGLPTGVERERGSRKPRRYFSPGESRKTSERFRTQPITSAERKESDRCTSHSETPTVDDEEKVDERAKLSVAAKRLLFREMEKSFDEQNVPKRRSRNTAVEQRLRRLQDRSLTQPITTEEVVIAATEPIPASCSGGTHPVMARLPSPTVARSAVQPARLQASAHQKALAKDQTNEGKELAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRIDTRQRRMNARYQTQPVTLGEVEQVQSGKLIPFSPAVNTSVSTVASTVAPMYAGDLRTKPPLDHNASATDYKFSSSIENSDSPVRSILKSQAWQPLVEGSENKGMLREYGETESKRALTGRDSGMEKYGSFEEAEASYPILNRAREGDSHKESKYAVPRRGSLERANPPITHLGDEPKEFSMAKMNAQGNLDLRDRLPFEEKVEVENVMKRKFSLRAAEFGEPTSEQTGTAAGKTIAQTTAPVSWKPQDSSEQPQEKLCKNPCAMFAAGEIKTPTGEGLLDSPSKTMSIKERLALLKKSGEEDWRNRLSRRQEGGKAPASSLHTQEAGRSLIKKRVTESRESQMTIEERKQLITVREEAWKTRGRGAANDSTQFTVAGRMVKKGLASPTAITPVASPICGKTRGTTPVSKPLEDIEARPDMQLESDLKLDRLETFLRRLNNKVGGMHETVLTVTGKSVKEVMKPDDDETFAKFYRSVDYNMPRSPVEMDEDFDVIFDPYAPKLTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNSNNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQTIEEGINTHTHAAKDFWKLLGGQTSYQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALGRRDRKAYDCMLQDPGSFNFAPRLFILSSSSGDFAATEFVYPARAPSVVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCKGKNLKKPAPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF spt20_human Spermatogenesis-associated protein 20 Sperm-specific protein 411 SPATA20 protein protein human Homo sapiens Human MLGARAWLGRVLLLPRAGAGLAASRRGSSSRDKDRSATVSSSVPMPAGGKGSHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYSQAFQLSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTLLNSGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRLQDTQDKLFWDSQGGGYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALVQCVHSVYIPNKVLILADGDPSSFLSRQLPFLSTLRRLEDQATAYVCENQACSVPITDPCELRKLLHP cox5a_human Cytochrome c oxidase subunit 5A, mitochondrial Cytochrome c oxidase polypeptide Va COX5A protein protein human Homo sapiens Human MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV snx3_human Sorting nexin-3 Protein SDP3 SNX3 protein protein human Homo sapiens Human MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA tnni3_human Troponin I, cardiac muscle Cardiac troponin I TNNI3 TNNC1 protein protein human Homo sapiens Human MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES ankr1_human Ankyrin repeat domain-containing protein 1 C193 CARP Cardiac ankyrin repeat protein Cytokine-inducible gene C-193 protein Cytokine-inducible nuclear protein HA1A2 ANKRD1 protein protein human Homo sapiens Human MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF comd4_human COMM domain-containing protein 4 COMMD4 protein protein human Homo sapiens Human MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG enoa_human Alpha-enolase ENO1 ENO1L1 MBPB1 MPB1 2-phospho-D-glycerate hydro-lyase Non-neural enolase Enolase 1 Phosphopyruvate hydratase C-myc promoter-binding protein MBP-1 MPB-1 Plasminogen-binding protein protein protein human Homo sapiens Human MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK enob_human Beta-enolase ENO3 2-phospho-D-glycerate hydro-lyase Enolase 3 Muscle-specific enolase Skeletal muscle enolase protein protein human Homo sapiens Human MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAIFAGRKFRNPKAK kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ kap0_human cAMP-dependent protein kinase type I-alpha regulatory subunit Tissue-specific extinguisher 1 PRKAR1A PKR1 PRKAR1 TSE1 protein protein human Homo sapiens Human MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV kap0_rat cAMP-dependent protein kinase type I-alpha regulatory subunit Prkar1a protein protein rat Rattus norvegicus (Rat) Rat MASGSMAASEEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGTAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV kap2_rat cAMP-dependent protein kinase type II-alpha regulatory subunit Prkar2a protein protein rat Rattus norvegicus (Rat) Rat MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDSFIAPPTTFHAQESSGVPVIEEDGESESDSDDEDLEVPIPSKFTRRVSVCAETFNPDEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSDGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSKTKTNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNLDLLDPGQ ankr1_rat Ankyrin repeat domain-containing protein 1 Cardiac adriamycin-responsive protein Cardiac ankyrin repeat protein Ankrd1 Carp protein protein rat Rattus norvegicus (Rat) Rat MMVFRVEELVTGKKNSNGSSGEFLPGEFRNGEYEAAVALEKQEDLKTLPANSVNLGEEQRKSEKVREAELKKKKLEQRSKLENLEDLEIIVQLKKRKKYKKTKVPVVKEPEPEIITEPVDVPRFLKAALENKLPVVEKFLSDKNSPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWACRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTFGADLNVKNCAGKTPMDLVLHWQNGTKAIFDSLKENAYKNSRIATF enoa_rat Alpha-enolase 2-phospho-D-glycerate hydro-lyase Non-neural enolase Enolase 1 Eno1 Eno-1 protein protein rat Rattus norvegicus (Rat) Rat MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKSAIAKAGYTDQVVIGMDVAASEFYRAGKYDLDFKSPDDASRYITPDQLADLYKSFIKDYPVVSIEDPFDQDDWDAWQKFTATAGIQVVGDDLTVTNPKRIAKAAGEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK enob_rat Beta-enolase 2-phospho-D-glycerate hydro-lyase Enolase 3 Muscle-specific enolase Skeletal muscle enolase Eno3 Eno-3 protein protein rat Rattus norvegicus (Rat) Rat MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLKAVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVDIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAVFAGRKFRNPKAK tnni3_rat Troponin I, cardiac muscle Cardiac troponin I Tnni3 Ctni Tni protein protein rat Rattus norvegicus (Rat) Rat MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRGEKGRVLSTRCQPLVLDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG mybpc3-pde4dip-1 1795832 N/A 1795839 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1795840 unspecified role unspecified role prey prey physical association physical association false false false Table1 mybpc3-pde4dip-2 1795832 N/A 1795839 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1795841 unspecified role unspecified role prey prey physical association physical association false false false Table1-2 mybpc3-actc1-1 1795832 N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 1795842 unspecified role unspecified role prey prey physical association physical association false false false Table1-3 mybpc3-actb-1 1795832 N/A 1795843 unspecified role unspecified role prey prey N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false Table1-4 mybpc3-myzap-1 1795832 N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 1795844 unspecified role unspecified role prey prey physical association physical association false false false Table1-5 mybpc3-flnc-1 1795832 N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 1795845 unspecified role unspecified role prey prey physical association physical association false false false Table1-6 mybpc3-pard3-1 1795832 N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 1795846 unspecified role unspecified role prey prey physical association physical association false false false Table1-8 mybpc3-cct7-1 1795832 N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 1795847 unspecified role unspecified role prey prey physical association physical association false false false Table1-9 mybpc3-cct7-2 1795832 N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 1795848 unspecified role unspecified role prey prey physical association physical association false false false Table1-10 mybpc3-svil-1 1795832 N/A 1795839 unspecified role unspecified role bait bait Q14896:p.[Ser275Glu;Ser284Glu;Ser304Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 1795849 unspecified role unspecified role prey prey physical association physical association false false false Table1-11 mybpc3-pde4dip-9 1795832 N/A 1795840 unspecified role unspecified role bait bait N/A 1795850 unspecified role unspecified role prey prey physical association physical association false false false Text near to Table2 pde4dip-snx3-1 1795832 N/A 1795851 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Text near to Table2 i pde4dip-snx3-2 1795832 N/A 1795852 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Table 2 pde4dip-tnni3-2 1795832 N/A 1795853 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Table 2-2 pde4dip-ankrd1-1 1795832 N/A 1795854 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Table 2-3 pde4dip-commd4-1 1795832 N/A 1795855 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Table 2-4 pde4dip-eno1-1 1795832 N/A 1795856 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Table 2-5 mybpc3-pde4dip-3 1795833 N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795839 unspecified role unspecified role neutral component neutral component c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 1 isoproterenol -an beta-adrenergic agonist It has been assumed the non-mutated form of cMyBPC was used here, as Isoproterenol was added to stimulate phosphorylation of the MyBPC-motif, which would not be possible if the serine residues were not present. mybpc3-pde4dip-7 1795833 N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795857 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 3B pde4dip-prkar2a-1 1795833 N/A 1795858 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 3Bi pde4dip-prkar2a-3 1795833 N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795853 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 4 ankrd1-pde4dip-1 1795833 N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795854 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 4-1 commd4-pde4dip-1 1795833 N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795855 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 4-2 eno1-pde4dip-1 1795833 N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795856 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 4-3 mybpc3-pde4dip-10 1795833 N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795852 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 5A pde4dip-tnni3-3 1795833 N/A 1795852 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795840 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 5B isoproterenol -an beta-adrenergic agonist pde4dip-prkar1a-4 1795834 N/A 1795859 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3C pde4dip-prkar1a-2 1795834 N/A 1795840 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795860 unspecified role unspecified role prey prey physical association physical association false false false Figure 3Ci ankrd1-pde4dip-3 1795834 N/A 1795840 unspecified role unspecified role bait bait n_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795861 unspecified role unspecified role prey prey physical association physical association false false false Figure 6i-B eno1-pde4dip-3 1795834 N/A 1795840 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795862 unspecified role unspecified role prey prey physical association physical association false false false Figure 6ii-B eno3-pde4dip-1 1795834 N/A 1795840 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795863 unspecified role unspecified role prey prey physical association physical association false false false Figure 6iii-B tnni3-pde4dip-1 1795834 N/A 1795840 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795864 unspecified role unspecified role prey prey physical association physical association false false false Figure 6iv-B pde4dip-prkar1a-3 1795835 N/A 1795859 unspecified role unspecified role bait bait N/A 1795840 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3C pde4dip-prkar2a-2 1795835 N/A 1795840 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795860 unspecified role unspecified role bait bait physical association physical association false false false Figure 3Ci ankrd1-pde4dip-2 1795835 N/A 1795840 unspecified role unspecified role prey prey n_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795861 unspecified role unspecified role bait bait physical association physical association false false false Figure 6i-A eno1-pde4dip-2 1795835 N/A 1795840 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795862 unspecified role unspecified role bait bait physical association physical association false false false Figure 6ii-A eno3-pde4dip-2 1795835 N/A 1795840 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795863 unspecified role unspecified role bait bait physical association physical association false false false Figure 6iii-A eno3-pde4dip-3 1795835 N/A 1795840 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795864 unspecified role unspecified role bait bait physical association physical association false false false Figure 6iv-A mybpc3-pde4dip-5 1795836 N/A 1795840 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795839 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 2B pde4dip-mybpc3-1 1795836 N/A 1795840 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795839 unspecified role unspecified role prey prey c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 2B pde4dip-tnni3-4 1795836 N/A 1795840 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795854 unspecified role unspecified role prey prey n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 6v-B pde4dip-commd4-2 1795836 N/A 1795840 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1795854 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 6v-A mybpc3-pde4dip-6 1795837 N/A 1795857 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Figure 3A pde4dip-prkar1a-1 1795837 N/A 1795858 unspecified role unspecified role prey prey N/A 1795840 unspecified role unspecified role bait bait physical association physical association false false false Figure 3A pde4dip-tnni3-1 1795837 N/A 1795840 unspecified role unspecified role bait bait N/A 1795852 unspecified role unspecified role prey prey physical association physical association false false false Figure 3A Positive control mybpc3-pde4dip-4 1795838 N/A 1795840 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 1795839 unspecified role unspecified role bait bait c1_c2_domains sufficient to bind sufficient binding region sufficient to bind range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Figure 2A MMGL interacts with the native as well as the trisphospho-mimic form of cMyBPC.