bhf-ucl varelas-2010-1 The Hippo pathway regulates Wnt/beta-catenin signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca Dev. Cell (1534-5807) 2010 imex curation Only protein-protein interactions varelas-2010-3 The Hippo pathway regulates Wnt/beta-catenin signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. lumier luminescence based mammalian interactome mapping lumier tag luciferase tag visualisation by luciferase assay tag luciferase Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins I did not annotate interactions between TAZ and beta-TRCP, shown in Figure S3, as the species of beta-TRCP is unknown. liliana.attisano@utoronto.ca Dev. Cell (1534-5807) 2010 imex curation Only protein-protein interactions varelas-2010-2 The Hippo pathway regulates Wnt/beta-catenin signaling. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca Dev. Cell (1534-5807) 2010 imex curation Only protein-protein interactions varelas-2010-5 The Hippo pathway regulates Wnt/beta-catenin signaling. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca Dev. Cell (1534-5807) 2010 imex curation Only protein-protein interactions varelas-2010-6 The Hippo pathway regulates Wnt/beta-catenin signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. lumier luminescence based mammalian interactome mapping lumier tag luciferase tag visualisation by luciferase assay tag luciferase Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins An anti-bait antibody was used for the IP instead of the usual anti-flag. liliana.attisano@utoronto.ca Dev. Cell (1534-5807) 2010 imex curation Only protein-protein interactions wwtr1_human WW domain-containing transcription regulator protein 1 Transcriptional coactivator with PDZ-binding motif WWTR1 TAZ protein protein human Homo sapiens Human MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL dvl1_human Segment polarity protein dishevelled homolog DVL-1 DVL1 DSH homolog 1 protein protein human Homo sapiens Human MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM dvl3_human Segment polarity protein dishevelled homolog DVL-3 DVL3 KIAA0208 DSH homolog 3 protein protein human Homo sapiens Human MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM dvl2_human Segment polarity protein dishevelled homolog DVL-2 DSH homolog 2 DVL2 protein protein human Homo sapiens Human MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM q5r2u3_human CK1E protein protein human Homo sapiens Human TNVPFDHLGK yap1_drome Transcriptional coactivator yorkie yki Protein yorkie Transcriptional coactivator YAP1 homolog CG4005 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCSNLFNDAQAIVNPPSSHKPDDLEWYKIN dsh_drome Segment polarity protein dishevelled dsh CG18361 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDADRGGGQETKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDADFGVVKEEIADDSTILPCFNGRVVSWLVSADGTNQSDNCSELPTSECELGMGLTNRKLQQQQQQHQQQQQQQQQQHQQQQQQQQQQVQPVQLAQQQQQQVLHHQKMMGNPLLQPPPLTYQSASVLSSDLDSTSLFGTESELTLDRDMTDYSSVQRLQVRKKPQRRKKRAPSMSRTSSYSSITDSTMSLNIITVSINMEAVNFLGISIVGQSNRGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDVNFENMTNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTQALTSHDSIIADIAEPIKERLDQNNLEEIVKAMTKPDSGLEIRDRMWLKITIPNAFIGADAVNWVLENVEDVQDRREARRIVSAMLRSNYIKHTVNKLTFSEQCYYVVNEERNPNLLGRGHLHPHQLPHGHGGHALSHADTESITSDIGPLPNPPIYMPYSATYNPSHGYQPIQYGIAERHISSGSSSSDVLTSKDISASQSDITSVIHQANQLTIAAHGSNKSSGSSNRGGGGGGGGGGNNTNDQDVSVFNYVL lats1_human Serine/threonine-protein kinase LATS1 Large tumor suppressor homolog 1 WARTS protein kinase LATS1 WARTS protein protein human Homo sapiens Human MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQNVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNMELYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV taz_human Tafazzin TAFAZZIN EFE2 G4.5 Protein G4.5 TAZ protein protein human Homo sapiens Human MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR dvl1-taz 1475010 n/a 1475015 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475016 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3A dvl3-taz-1 1475010 n/a 1475015 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475017 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3A taz-dvl2-1 1475010 n/a 1475015 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475018 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false These two regions contain the PDZ domain and a PY motif respectively. physical association physical association false false false Fig. 3A, D dvl2-ck1e 1475010 n/a 1475018 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1475019 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 4D human Flag-TAZ taz-dvl2 1475011 n/a 1475018 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475015 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false pdz and ww domains required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false The interaction between TAZ and Dvl2 is not abolished, but reduced by ~ 75% in the absence of the two domains. physical association physical association false false false Fig. 3C dvl1-wwtr1 1475011 n/a 1475016 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475015 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false pdz domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false S1B dvl2-wwtr1 1475011 n/a 1475018 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475015 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false pdz domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. S1B wwtr1-dvl2 1475011 n/a 1475020 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475021 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false pdz and py motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false The interaction is not completely abolished, but ~ 75% reduced when both elements are missing. physical association physical association false false false Fig. S7 taz-dvl2-2 1475012 n/a 1475018 unspecified role unspecified role prey prey n/a 1475015 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3B taz-lats1 1475012 n/a 1475015 unspecified role unspecified role bait bait cell lysate cell lysate n/a 1475022 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false Fig 5A dvl2-taz-2 1475013 n/a 1475018 unspecified role unspecified role bait bait n/a 1475023 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 6B human LATS1 dvl2-ck1e-1 1475014 n/a 1475019 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus luciferase tag luciferase tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475018 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4E human 3Flag-TAZ containing DVL2-binding region.