IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ franceschini-2008-2 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Franceschini S., Ilari A., Verzili D., Zamparelli C., Antaramian A., Rueda A., Valdivia HH., Chiancone E., Colotti G. Cardiac - Interactions involving cardiac related proteins gianni.colotti@uniroma1.it FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2008 Only protein-protein interactions imex curation imex curation franceschini-2008-3 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Franceschini S., Ilari A., Verzili D., Zamparelli C., Antaramian A., Rueda A., Valdivia HH., Chiancone E., Colotti G. Cardiac - Interactions involving cardiac related proteins Spectrofluorimetric determination of the calcium ion affinity of wt- and F112L-sorcin using the fluorescent calcium chelator Fluo3;calcium binding to Fluo3 results in an increase in emission intensity. gianni.colotti@uniroma1.it FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2008 Only protein-protein interactions imex curation imex curation franceschini-2008-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Franceschini S., Ilari A., Verzili D., Zamparelli C., Antaramian A., Rueda A., Valdivia HH., Chiancone E., Colotti G. Cardiac - Interactions involving cardiac related proteins gianni.colotti@uniroma1.it FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2008 Only protein-protein interactions imex curation imex curation franceschini-2008-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Franceschini S., Ilari A., Verzili D., Zamparelli C., Antaramian A., Rueda A., Valdivia HH., Chiancone E., Colotti G. Cardiac - Interactions involving cardiac related proteins gianni.colotti@uniroma1.it FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2008 Only protein-protein interactions imex curation imex curation p30626-1 Sorcin 22 kDa protein CP-22 V19 SRI protein protein human Homo sapiens Human MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV calcium ion calcium ion calcium ion calcium ions small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) anxa7_human Annexin A7 ANXA7 ANX7 SNX Annexin-7 Annexin VII Synexin OK/SW-cl.95 protein protein human Homo sapiens Human MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPGGYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQPTYPSQINTDSFSSYPVFSPVSLDYSSEPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ sri-3 1796388 N/A 1796392 unspecified role unspecified role neutral component neutral component P30626-1:p.Phe112Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 6 sri-4 1796388 N/A 1796392 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 6i sri-5 1796389 N/A 1796392 unspecified role unspecified role neutral component neutral component P30626-1:p.Phe112Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1796393 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false 1796389 none- text between figs 6 and 7 The F112L mutation therefore results in a 5- to 6-fold decrease in the affinity for Ca2+. sri-6 1796389 N/A 1796393 unspecified role unspecified role neutral component neutral component N/A 1796392 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1796389 none- text between figs 6 and 7 The F112L mutation therefore results in a 5- to 6-fold decrease in the affinity for Ca2+. sri-7 1796390 N/A 1796392 unspecified role unspecified role prey prey P30626-1:p.Phe112Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1796394 unspecified role unspecified role bait bait N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1796390 Figure 7 By assuming that the sorcin dimer contains a single effective annexin VII binding site, the analysis yields KD values of 1.25 μM for wt-sorcin and 13.5 μM for F112L-sorcin. sri-8 1796390 N/A 1796394 unspecified role unspecified role bait bait N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1796392 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1796390 Figure 7 By assuming that the sorcin dimer contains a single effective annexin VII binding site, the analysis yields KD values of 1.25 μM for wt-sorcin and 13.5 μM for F112L-sorcin. sri-1 1796391 N/A 1796392 unspecified role unspecified role neutral component neutral component P30626-1:p.Phe112Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Table 1 2.5A R work 0.252 R free 0.289