bhf-ucl de-1992-2 The fms-like tyrosine kinase, a receptor for vascular endothelial growth factor. in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra de Vries C., Escobedo J.A., Ueno H., Houck K., Ferrara N., Williams L.T. Cardiac - Interactions involving cardiac related proteins After the cross-linking treatment, the cells were lysed and the lysates were partially purified by binding to wheat germ agglutinin Sepharose (VEGFR1 was the bait). The samples were then analyzed by SDS-polyacrylamide gel electrophoresis. Bis-Sulfosuccinimidyl)-suberate BS3 Science (0036-8075) 1992 imex curation Only protein-protein interactions de-1992-1 The fms-like tyrosine kinase, a receptor for vascular endothelial growth factor. in vitro In vitro competition binding competition binding tag visualisation tag visualisation de Vries C., Escobedo J.A., Ueno H., Houck K., Ferrara N., Williams L.T. Cardiac - Interactions involving cardiac related proteins COS cells were transiently transfected with the expression vector containing the flt cDNA or the PDGF receptor cDNA. After transfection the cells were incubated with binding medium containing 125I-VEGF-VPF and the corresponding concentrations of unlabeled ligand. The cells were then washed and lysed. The soluble lysates were counted in a gamma counter. Science (0036-8075) 1992 imex curation Only protein-protein interactions vgfr1_human Vascular endothelial growth factor receptor 1 Vascular permeability factor receptor Tyrosine-protein kinase receptor FLT Tyrosine-protein kinase FRT Fms-like tyrosine kinase 1 FLT1 FLT FRT VEGFR1 protein protein human Homo sapiens Human MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFIRKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTWTDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCSPPPDYNSVVLYSTPPI p15692-4 Vascular endothelial growth factor A VEGF VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR flt1-vegfa-12 1467782 n/a 1467784 unspecified role unspecified role neutral component neutral component chlae-cos Chlorocebus aethiops cos cos n/a 1467785 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false Fig. 3 flt1-vegfa-13 1467782 n/a 1467784 unspecified role unspecified role neutral component neutral component chlae-cos Chlorocebus aethiops cos cos n/a 1467785 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1467785 competitor competitor competitor neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false Fig. 3 flt1-vegfa-7 1467783 n/a 1467784 unspecified role unspecified role bait bait chlae-cos Chlorocebus aethiops cos cos n/a 1467785 competitor competitor competitor prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1467785 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false Fig.2