IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ takeda-2003-1 Structure of the core domain of human cardiac troponin in the Ca(2+)-saturated form. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Takeda S., Yamashita A., Maeda K., Maéda Y. Cardiac - Interactions involving cardiac related proteins PDBe entries quote Troponin T sequence as (P45379) aas 193 - 298. However this publication quotes aas 183–288. stakeda@ri.ncvc.go.jp Nature (0028-0836) 2003 Only protein-protein interactions imex curation tnnt2_human Troponin T, cardiac muscle TNNT2 Cardiac muscle troponin T protein protein human Homo sapiens Human MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK mint Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity homomint Defects in TNNT2 are the cause of familial hypertrophic cardiomyopathy type 2 (CMH2) [MIM:115195]; also designated FHC or HCM. Familial hypertrophic cardiomyopathy [MIM:192600] is a heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The prevalence of the disease in the general population is 0.2%. FHC is clinically heterogeneous, with inter- and intrafamilial variations ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death Defects in TNNT2 are the cause of dilated cardiomyopathy 1D (CMD1D) [MIM:601494]. Dilated cardiomyopathy [MIM:115200] is a disorder characterized by cardiac dilation and reduced systolic function. CMD1D inheritance is autosomal dominant tnnc1_human Troponin C, slow skeletal and cardiac muscles TNNC1 TNNC protein protein human Homo sapiens Human MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE tnni3_human Troponin I, cardiac muscle Cardiac troponin I TNNI3 TNNC1 protein protein human Homo sapiens Human MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES tnnc1-tnni3-tnnt2 1599444 n/a 1599445 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1599446 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1599447 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Table 1 3.3 angstrom Rwork = 0.25 Rfree = 0.31 tnnc1-tnni3-1 1599444 n/a 1599445 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1599446 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1599447 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Table 1 2.6 angstrom Rwork = 0.26 Rfree = 0.30