bhf-ucl hofmann-2000-1 Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de J. Cell. Sci. (0021-9533) 2000 imex curation cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. Only protein-protein interactions hofmann-2000-2 Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de J. Cell. Sci. (0021-9533) 2000 imex curation cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. Only protein-protein interactions hofmann-2000-3 Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de J. Cell. Sci. (0021-9533) 2000 imex curation cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. Only protein-protein interactions hofmann-2000-4 Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de J. Cell. Sci. (0021-9533) 2000 imex curation cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. Only protein-protein interactions hofmann-2000-5 Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de J. Cell. Sci. (0021-9533) 2000 imex curation cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. Only protein-protein interactions q13835-2 Plakophilin-1 1a PKP1 Band 6 protein protein protein human Homo sapiens Human MNHSPLKTALAYECFQDQDNSTLALPSDQKMKTGTSGRQRVQEQVMMTVKRQKSKSSQSSTLSHSNRGSMYDGLADNYNYGTTSRSSYYSKFQAGNGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCNTTGAGSDICFMQKIKASRSEPDLYCDPRGTLRKGTLGSKGQKTTQNRYSFYSTCSGQKAIKKCPVRPPSCASKQDPVYIPPISCNKDLSFGHSRASSKICSEDIECSGLTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF k2c5_human Keratin, type II cytoskeletal 5 Cytokeratin-5 58 kDa cytokeratin KRT5 Keratin-5 Type-II keratin Kb5 protein protein human Homo sapiens Human MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGGAGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEINFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGVGLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS k1c15_human Keratin, type I cytoskeletal 15 KRT15 KRTB Cytokeratin-15 Keratin-15 protein protein human Homo sapiens Human MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGYGGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIAIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI k1c18_human Keratin, type I cytoskeletal 18 KRT18 CYK18 Keratin-18 PIG46 Cytokeratin-18 Cell proliferation-inducing gene 46 protein protein protein human Homo sapiens Human MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH k2c8_human Keratin, type II cytoskeletal 8 Keratin-8 KRT8 CYK8 Cytokeratin-8 Type-II keratin Kb8 protein protein human Homo sapiens Human MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK k1c14_human Keratin, type I cytoskeletal 14 Cytokeratin-14 KRT14 Keratin-14 protein protein human Homo sapiens Human MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSGGACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE pkp2_human Plakophilin-2 PKP2 protein protein human Homo sapiens Human MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQTVKSLRIQEQVQQTLARKGRSSVGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRYARSEIVGVSRAGTTSRQRHFDTYHRQYQHGSVSDTVFDSIPANPALLTYPRPGTSRSMGNLLEKENYLTAGLTVGQVRPLVPLQPVTQNRASRSSWHQSSFHSTRTLREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADMEMTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALRNLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITDHTVNLRSRNGWPGAVAHACNPSTLGGQGGRITRSGVRDQPDQHGLLWNLSSNDKLKNLMITEALLTLTENIIIPFSGWPEGDYPKANGLLDFDIFYNVTGCLRNMSSAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKYSQNIYIQNRNIQTDNNKSIGCFGSRSRKVKEQYQDVPMPEEKSNPKGVEWLWHSIVIRMYLSLIAKSVRNYTQEASLGALQNLTAGSGPMPTSVAQTVVQKESGLQHTRKMLHVGDPSVKKTAISLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNIIQNSYQNARDLLNTGGIQKIMAISAGDAYASNKASKAASVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD desm_mouse Desmin Des protein protein mouse Mus musculus Mouse MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSMTSRVYQVSRTSGGAGGLGSLRSSRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEANGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL desp_human Desmoplakin DSP 250/210 kDa paraneoplastic pemphigus antigen protein protein human Homo sapiens Human MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHSQTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKDYELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSEEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEVSQRKQQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCLEDENARLQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQNSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLEQASIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDKNATILELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLISPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSSMGSGVSDDVFSSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH krt5-pkp1-3 1455042 n/a PKP1a 1455047 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a CK5 1455048 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2A krt15-pkp1 1455042 n/a CK15 1455049 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a PKP1a 1455047 unspecified role unspecified role prey prey partially purified partially purified his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 2A(c) pkp1-krt5 1455042 n/a CK5 1455048 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) n/a PKP1a 1455047 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2B lane1 krt18-pkp1-2 1455042 n/a CK18 1455050 unspecified role unspecified role bait bait partially purified partially purified rod domain sufficient to bind sufficient binding region sufficient to bind autoradiography autoradiography range range range range false 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a PKP1a 1455047 unspecified role unspecified role prey prey partially purified partially purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 2A data not shown krt8-pkp1-2 1455042 n/a PKP1a 1455047 unspecified role unspecified role prey prey partially purified partially purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1455051 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rod sufficient to bind sufficient binding region sufficient to bind range range range range false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2A data not shown pkp1-krt14 1455042 n/a 1455052 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) n/a PKP1a 1455047 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2B lane2 pkp1-krt8-2 1455042 n/a 1455051 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) n/a PKP1a 1455047 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2B lane3 pkp1-krt18-3 1455042 n/a 1455050 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) n/a PKP1a 1455047 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2B lane 4 pkp1-vim-2 1455042 n/a 1455053 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) n/a PKP1a 1455047 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2B lane 5 pkp2-krt5 1455042 n/a CK5 1455048 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) n/a 1455054 autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig 2B lane1 panel 3 pkp2-krt14 1455042 n/a PKP2a 1455054 autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1455052 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 2B lane2 panel 3 pkp2-krt8 1455042 n/a 1455054 autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false non-arm-repeat domain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1455051 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 2B lane3 panel3 and data not shown pkp2-krt18 1455042 n/a 1455054 autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes non-arm-repeat domain n/a 1455050 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 2B lane 4 panel 3 and data not shown pkp2-vim 1455042 n/a 1455054 autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false non-arm-repeat domain n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1455053 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 2B lane 5 panel 3 and data not shown krt18-krt8-1 1455043 n/a PKP1a 1455047 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1455051 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1455050 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod domain required to bind necessary binding region required to bind range range range range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig 5 and 6 On their own, CK8 as well as CK18, like PKP1a, remained in the supernatant fraction. Therefore both CK8 and CK18 are required for this association with PKP1a to be detected using this method krt14-krt5-1 1455043 n/a 1455052 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a CK5 1455048 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a PKP1a 1455047 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Fig 6 vim-pkp1-2 1455043 n/a 1455053 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a PKP1a 1455047 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig 6 krt18-krt8-2 1455043 n/a 1455051 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1455050 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod domain required to bind necessary binding region required to bind range range range range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig 5 lane 10,11 pkp1-vim-1 1455044 n/a PKP1a 1455047 predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified ecoli Escherichia coli (strain K12) n/a 1455053 predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod domain sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 7 pkp1-krt18-2 1455044 n/a 1455050 predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod domain required to bind necessary binding region required to bind range range range range false ecoli Escherichia coli (strain K12) n/a 1455051 predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) n/a PKP1a 1455047 predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified ecoli Escherichia coli (strain K12) association association false false false Fig 7 pkp1-des 1455044 n/a 1455055 predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod domain sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) n/a PKP1a 1455047 predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 7 pkp1-dsp 1455045 n/a PKP1a 1455047 unspecified role unspecified role bait bait n/a 1455056 unspecified role unspecified role prey prey physical association physical association false false false Fig 8 pkp1-dsp-1 1455046 n/a 1455056 unspecified role unspecified role prey prey n/a PKP1a 1455047 unspecified role unspecified role bait bait physical association physical association false false false Fig 8b