bhf-ucl pilon-2000-1 Apolipoprotein AII enrichment of HDL enhances their affinity for class B type I scavenger receptor but inhibits specific cholesteryl ester uptake. human-nci_h295r Human NCI-H295R Adrenocortical Carcinoma nci_h295r Human NCI-H295R Adrenocortical Carcinoma http://www.lgcstandards-atcc.org/products/all/CRL-2128.aspx?geo_country=gb#357C3571006A4259B64650D34DF19048 bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink western blot western blot Immuno blot Immuno blot Pilon A., Briand O., Lestavel S., Copin C., Majd Z., Fruchart J.C., Castro G., Clavey V. Cardiac - Interactions involving cardiac related proteins author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. Source of protein ApoA1 is human as it is isolated from human plasma as per author reference Mezdour et al., 1987, PMID: 3106390. Source of protein SR-B1 is human as it is endogenous to human cell line used. Veronique.Clavey@pasteur-lille.fr Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2000 imex curation Only protein-protein interactions pilon-2000-2 Apolipoprotein AII enrichment of HDL enhances their affinity for class B type I scavenger receptor but inhibits specific cholesteryl ester uptake. human-nci_h295r Human NCI-H295R Adrenocortical Carcinoma nci_h295r Human NCI-H295R Adrenocortical Carcinoma http://www.lgcstandards-atcc.org/products/all/CRL-2128.aspx?geo_country=gb#357C3571006A4259B64650D34DF19048 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pilon A., Briand O., Lestavel S., Copin C., Majd Z., Fruchart J.C., Castro G., Clavey V. Cardiac - Interactions involving cardiac related proteins author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. Source of protein ApoA1 is human as it is isolated from human plasma as per author reference Mezdour et al., 1987, PMID: 3106390. Source of protein SR-B1 is human as it is endogenous to human cell line used. Veronique.Clavey@pasteur-lille.fr Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2000 imex curation Only protein-protein interactions 1-hexadecanoyl-2-(9z-octadecenoyl)-sn-glycero-3-phosphocholine 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine 1-16:0-2-18:1-phosphatidylcholine 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine 1-hexadecanoyl-2-oleoyl-sn-glycero-3-phosphocholine 1-Palmitoyl-2-oleoyl-lecithin 1-Palmitoyl-2-oleoylphosphatidylcholine 1-Palmotoyl-2-oleoylglycero-3-phosphocholine 1-Popc 16:0-18:1-PC GPCho(16:0/18:1) GPCho(16:0/18:1omega9) GPCho(34:1) Lecithin Palmitoyloleoylphosphatidylcholine PC(16:0/18:1(9Z)) PC(16:0/18:1) PC(16:0/18:1) PC(16:0/18:1omega9) PC(34:1) Phosphatidylcholine(16:0/18:1) Phosphatidylcholine(16:0/18:1omega9) Phosphatidylcholine(34:1) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) WTJKGGKOPKCXLL-VYOBOKEXSA-N scrb1_human Scavenger receptor class B member 1 SCARB1 CD36L1 CLA1 SR-BI CD36 antigen-like 1 CD36 and LIMPII analogous 1 Collagen type I receptor, thrombospondin receptor-like 1 protein protein human Homo sapiens Human MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLEGLGPSLGGGTGS apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ 1_hexadecanoyl_2__9z_octadecenoyl__sn_glycero_3_phosphocholine-apoa1-2 1450139 n/a 1450141 unspecified role unspecified role ancillary ancillary n/a 1450142 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role neutral component neutral component n/a 1450143 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false Figures 1 A This binary interaction does not take place In the abscence of palmitoyl-oleoyl-phosphatidylcholine (POPC)-A1. scarb1-apoa1 1450140 n/a 1450142 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait n/a 1450143 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey purified purified n/a 1450141 unspecified role unspecified role ancillary ancillary physical association physical association false false false Figures 1 B