MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint pack_chung-2000-1 Presenilin 2 interacts with sorcin, a modulator of the ryanodine receptor. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Pack-Chung E., Meyers MB., Pettingell WP., Moir RD., Brownawell AM., Cheng I., Tanzi RE., Kim TW. Virus - Publications including interactions involving viral proteins Alzheimers - Interactions investigated in the context of Alzheimers disease Cardiac - Interactions involving cardiac related proteins J. Biol. Chem. (0021-9258) 2000 packchun-2000-1 Presenilin 2 interacts with sorcin, a modulator of the ryanodine receptor. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Pack-Chung E., Meyers MB., Pettingell WP., Moir RD., Brownawell AM., Cheng I., Tanzi RE., Kim TW. Virus - Publications including interactions involving viral proteins Alzheimers - Interactions investigated in the context of Alzheimers disease Cardiac - Interactions involving cardiac related proteins J. Biol. Chem. (0021-9258) 2000 psn2_human Presenilin-2 PSEN2 AD4 PS2 PSNL2 STM2 STM-2 E5-1 AD3LP AD5 protein protein human Homo sapiens Human MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI sorcn_human Sorcin 22 kDa protein CP-22 V19 SRI protein protein human Homo sapiens Human MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV A4829C7650A5E3FA sri-psen2 1683 psn2_human 1685 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 sorcn_human 1686 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint sri-psen2-1 1684 sorcn_human 1686 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 psn2_human 1685 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false homomint mint