IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yuan-1998-1 The C. elegans MDL-1 and MXL-1 proteins can functionally substitute for vertebrate MAD and MAX. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yuan J., Tirabassi RS., Bush AB., Cole MD. Cancer - Interactions investigated in the context of cancer Oncogene (0950-9232) 1998 yuan-1998-2 The C. elegans MDL-1 and MXL-1 proteins can functionally substitute for vertebrate MAD and MAX. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yuan J., Tirabassi RS., Bush AB., Cole MD. Cancer - Interactions investigated in the context of cancer In this ligand blotting assay, MDL-1 and MXL-1 were electrophoresed on SDS polyacrylamide gels, then transfered onto nylon membranes and allowed to renature. The membranes were probed with either 32P-labeled MDL-1 or MXL-1. Oncogene (0950-9232) 1998 mdl1_caeel Mad-like protein 1 mdl-1 R03E9.1 protein protein caeel Caenorhabditis elegans MEQQLNLGHLLTAARLLDIGALDISSLDLGALTSTSSSPGSSSPAMFDLSNESELRSLFCGKLKVDKKQSSCASNASTSSQPYCSSPPARKSSKHSRTAHNELEKTRRANLRGCLETLKMLVPCVSDATRNTTLALLTRARDHIIELQDSNAAQMKKLNDLRDEQDELVAELAQLQADEEVAQATSQACQTLSQSRPESRASSFTSTSSRDSPCYLEYSPSSKPMDSHKPTIIDLYAEGLIPRGPITFPRPLVYPHNVFDLMNLPPTPFDVSQFLPINLQV myc_max_consensus MYC/MAX vertebrate consensus binding sequence GATCCTGACGACCACGTGGTCTTACGCTAG dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) GATCCTGACGACCACGTGGTCTTACGCTAG mxl1_caeel Max-like protein 1 mxl-1 T19B10.11 protein protein caeel Caenorhabditis elegans MSDMSDLEDDQTGHCGSGEHSGPFDPKRHAREQHNALERRRRDNIKDMYTSLREVVPDANGERVQASRAVILKKAIESIEKGQSDSATLSVDVAEQESKNAKLREEIARLKAKKDPSSSQSIIQ max_mouse Protein max Myc-associated factor X Protein myn Myc-binding novel HLH/LZ protein Max Myn protein protein mouse Mus musculus Mouse MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS myc_mouse Myc proto-oncogene protein Proto-oncogene c-Myc Transcription factor p64 Myc protein protein mouse Mus musculus Mouse MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA mdl_1-mxl_1 The MDL-1-MXL-1 heterodimer binds the MYC/MAX consensus binding sequence in an EMSA assay 575636 N/A 575638 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 575639 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 575640 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) association association false false false 2 A max-mdl_1 The mouse MAX-MDL-1 heterodimer binds the MYC/MAX consensus binding sequence in an EMSA assay 575636 N/A 575638 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 575641 unspecified role unspecified role neutral component neutral component N/A 575639 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2 B The DNA binding of the MDL-1/MAX heterodimer was weaker than that of MDL-1/MXL-1. MDL-1 did not heterodimerize with mouse c-MYC. It is not specified what cell type the mouse MAX was expressed in. max-myc The mouse MYC-MAX heterodimer binds the MYC/MAX consensus binding sequence in an EMSA assay 575636 N/A 575642 unspecified role unspecified role neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 575639 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 575641 unspecified role unspecified role neutral component neutral component association association false false false 2 B, C It is not specified what cell type the mouse MAX and MYC were expressed in. myc_max_consensu_max The mouse MAX-MAX homodimer binds the MYC/MAX consensus binding sequence in an EMSA assay 575636 N/A 575639 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 575641 unspecified role unspecified role neutral component neutral component physical association physical association false false false 2 B, C It is not specified what cell type the mouse MAX was expressed in. mdl_1-mxl_1-1 MXL-1 binds MDL-1 in a Far Western blotting assay 575637 N/A 575640 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 575638 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3 B The 32P-labeled MXL-1 does not bind the filter-bound MXL-1. mxl_1-mdl_1-2 MDL-1 binds MXL-1 in a Far Western blotting assay 575637 N/A 575638 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 575640 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal RRASV motif tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3 C The 32P-labeled MDL-1 does not bind the filter-bound MDL-1.