IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ moura-2016-5 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-6 human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-9 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-1 human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. Stratified squamous epithelium from a normal human tonsil. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-2 human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-3 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-4 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-10 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions moura-2016-11 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Cancer - Interactions investigated in the context of cancer Results from Figure 2B have not been added as Sox2 was only purified by IP with no further purification. plazozbi@usal.es,pedro.lazo@csic.es plazozbi@usal.es imex curation Moura DS., Fernández IF., Marín-Royo G., López-Sánchez I., Martín-Doncel E., Vega FM., Lazo PA. 2016-05-15: Pedro Lazo Scientific reports 2016 Only protein-protein interactions vrk1_human Serine/threonine-protein kinase VRK1 Vaccinia-related kinase 1 VRK1 protein protein human Homo sapiens Human MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK sox2_human Transcription factor SOX-2 SOX2 protein protein human Homo sapiens Human MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM sox2-vrk1-4 1894461 N/A 1894471 unspecified role unspecified role prey prey N/A 1894472 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2A vrk1-sox2-1 1894461 N/A 1894471 unspecified role unspecified role bait bait N/A 1894472 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A sox2-vrk1-5 1894462 N/A 1894471 unspecified role unspecified role prey prey N/A 1894472 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2A vrk1-sox2-2 1894462 N/A 1894471 unspecified role unspecified role bait bait N/A 1894472 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A vrk1-sox2-3 1894463 N/A 1894471 unspecified role unspecified role bait bait N/A 1894472 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A sox2-vrk1-6 1894463 N/A 1894471 unspecified role unspecified role prey prey N/A 1894472 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2A sox2-vrk1-7 1894464 N/A 1894471 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1894472 unspecified role unspecified role bait bait c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp. Fig. 2A, 2B vrk1-sox2-5 1894464 N/A 1894471 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1894472 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp. Fig. 2A sox2-vrk1-1 1894465 N/A 1894472 unspecified role unspecified role neutral component neutral component N/A 1894471 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 1B sox2-vrk2-2 1894466 N/A 1894471 unspecified role unspecified role neutral component neutral component N/A 1894472 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 1D sox2-vrk1-2 1894467 N/A 1894471 unspecified role unspecified role neutral component neutral component N/A 1894472 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp. Fig. 1A sox2-vrk1-3 1894468 N/A 1894471 unspecified role unspecified role neutral component neutral component N/A 1894472 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp. Fig. 1A vrk1-sox2-6 1894469 N/A 1894472 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1894471 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 2C sox2-vrk1-8 1894470 N/A 1894471 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1894472 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 2D