IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yoo-2016-3 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange tag fluorescence tag visualisation by fluorescence tag fluorescence Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer Replacement of ARF6-bound GDP with GTP-BODIPY was monitored by measuring increases in fluorescence intensity;Intrinsic fluorescence of GTP-BODIPY is intramolecularly quenched in the unbound state but fluorescence is significantly increased upon binding to a target protein such as ARF6. kostanin@nvgn.com,dean.li@u2m2.utah.edu Cancer cell 2016 imex curation Only protein-protein interactions yoo-2016-4 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange tag visualisation tag visualisation Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer kostanin@nvgn.com,dean.li@u2m2.utah.edu Cancer cell 2016 imex curation Only protein-protein interactions yoo-2016-1 human-mel_202 Homo sapiens uveal melanoma mel_202 Uveal melanoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer kostanin@nvgn.com,dean.li@u2m2.utah.edu Cancer cell 2016 imex curation Only protein-protein interactions yoo-2016-2 human-mel_92.1 human Human mel_92.1 Mel92.1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoo JH., Shi DS., Grossmann AH., Sorensen LK., Tong Z., Mleynek TM., Rogers A., Zhu W., Richards JR., Winter JM., Zhu J., Dunn C., Bajji A., Shenderovich M., Mueller AL., Woodman SE., Harbour JW., Thomas KR., Odelberg SJ., Ostanin K., Li DY. Cancer - Interactions investigated in the context of cancer kostanin@nvgn.com,dean.li@u2m2.utah.edu Cancer cell 2016 imex curation Only protein-protein interactions gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS nav2729 NAV2729 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cyh2_human Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 ARF nucleotide-binding site opener ARF exchange factor CYTH2 ARNO PSCD2L PSCD2 protein protein human Homo sapiens Human MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP iqec1_human IQ motif and SEC7 domain-containing protein 1 IQSEC1 ARFGEP100 BRAG2 KIAA0763 ADP-ribosylation factors guanine nucleotide-exchange protein 100 ADP-ribosylation factors guanine nucleotide-exchange protein 2 Brefeldin-resistant Arf-GEF 2 protein protein protein human Homo sapiens Human MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEGKQVSVTNDGSQLGALVSPECGDLSEPTTLKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTEPQTALHGMDHRKLDEMTASYSDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSCRSTPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKHGPHSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESSSRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDSYASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPSVLCS guanosine 5'-[gamma-thio]triphosphate GTP-gamma-S small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gnaq_human Guanine nucleotide-binding protein G(q) subunit alpha GNAQ GAQ Guanine nucleotide-binding protein alpha-q protein protein human Homo sapiens Human MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV arf6-gdp-1 2824266 N/A 2824270 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2824285 2824282 direct interaction direct interaction false false false 6 C/D/E/F arf6-gdp-2 2824266 N/A 2824273 inhibitor inhibitor neutral component neutral component N/A 2824270 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2824294 2824291 direct interaction direct interaction false false false 2824266 6 C/D/E/F arf6-gdp-5 2824266 N/A 2824274 ancillary ancillary neutral component neutral component sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2824270 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2824305 2824302 direct interaction direct interaction false false false 6 D arf6-cyth2-1 2824266 N/A 2824274 ancillary ancillary neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2824270 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2824273 inhibitor inhibitor neutral component neutral component 2824316 2824313 direct interaction direct interaction false false false 2824266 6 Di arf6-cyth2-2 2824266 N/A 2824275 ancillary ancillary neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region_including_partial_sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2824270 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2824273 inhibitor inhibitor neutral component neutral component 2824328 2824325 direct interaction direct interaction false false false 2824266 6 D-2 arf6-cyth2-3 2824266 N/A 2824275 ancillary ancillary neutral component neutral component region_including_partial_sec7_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2824270 cofactor cofactor coenzyme neutral component neutral component region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2824340 2824337 direct interaction direct interaction false false false 6 D-2i arf6-gdp-3 2824267 N/A 2824273 inhibitor inhibitor neutral component neutral component N/A 2824276 cofactor cofactor coenzyme neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2824349 2824346 direct interaction direct interaction false false false 2824267 6 C arf6-gdp-4 2824267 N/A 2824276 cofactor cofactor coenzyme neutral component neutral component region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824271 cofactor cofactor coenzyme neutral component neutral component whole_molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2824272 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2824357 2824354 direct interaction direct interaction false false false 6 C 245twes-1 2824268 N/A 2824277 unspecified role unspecified role bait bait P50148:p.Gln209Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false P50148:p.Arg210Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 2824275 unspecified role unspecified role prey prey physical association physical association false false false 4D gnaq-iqsec1-1 2824269 N/A 2824277 unspecified role unspecified role bait bait P50148:p.Gln209Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 2824275 unspecified role unspecified role prey prey physical association physical association false false false 4D