IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jinesh-2016-1 human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jinesh GG., Taoka R., Zhang Q., Gorantla S., Kamat AM. Cancer - Interactions investigated in the context of cancer 2016-04-09: Goodwin G. Jinesh, UT MD Anderson Cancer Center, Houston, TX, USA 77054 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. isoform data in Fig. 6D has not been added as the Antibody was raised to the invariant C-terminal of the protein and it is not possible to tell which of at least 3 possible isoforms the results refer to. goodwinjinesh@gmail.com,akamat@mdanderson.org Scientific reports 2015 Only protein-protein interactions imex curation jinesh-2016-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG., Taoka R., Zhang Q., Gorantla S., Kamat AM. Cancer - Interactions investigated in the context of cancer 2016-04-09: Goodwin G. Jinesh, UT MD Anderson Cancer Center, Houston, TX, USA 77054 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. isoform data in Fig. 6D has not been added as the Antibody was raised to the invariant C-terminal of the protein and it is not possible to tell which of at least 3 possible isoforms the results refer to. goodwinjinesh@gmail.com,akamat@mdanderson.org Scientific reports 2015 Only protein-protein interactions imex curation jinesh-2016-3 human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Jinesh GG., Taoka R., Zhang Q., Gorantla S., Kamat AM. Cancer - Interactions investigated in the context of cancer 2016-04-09: Goodwin G. Jinesh, UT MD Anderson Cancer Center, Houston, TX, USA 77054 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. isoform data in Fig. 6D has not been added as the Antibody was raised to the invariant C-terminal of the protein and it is not possible to tell which of at least 3 possible isoforms the results refer to. goodwinjinesh@gmail.com,akamat@mdanderson.org Scientific reports 2015 Only protein-protein interactions imex curation ncf1_human Neutrophil cytosol factor 1 NCF1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K 47 kDa autosomal chronic granulomatous disease protein Nox-organizing protein 2 Nox organizer 2 SH3 and PX domain-containing protein 1A NOXO2 SH3PXD1A protein protein human Homo sapiens Human MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV kpcz_human Protein kinase C zeta type PRKCZ PKC2 nPKC-zeta protein protein human Homo sapiens Human MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV ncf1-prkcz-1 1883124 N/A 1883127 unspecified role unspecified role bait bait N/A 1883128 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5D, 5E ncf1-prkcz-2 1883125 N/A 1883127 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1883128 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line physical association physical association false false false Fig. 5C S6K inhibitor BI-D1870 + TNF-alpha Interaction observed in the presence of serum ncf1-prkcz-3 1883126 N/A 1883128 unspecified role unspecified role neutral component neutral component N/A 1883127 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 5A Co-localization was increased upon serum withdrawal