IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kazakov-2015-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer permyakov.s@gmail.com Biochemical and biophysical research communications 2015 imex curation Only protein-protein interactions kazakov-2015-2 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer permyakov.s@gmail.com Biochemical and biophysical research communications 2015 imex curation Only protein-protein interactions kazakov-2015-3 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE., Kazakov AS., Sokolov AS., Rastrygina VA., Solovyev VV., Ismailov RG., Mikhailov RV., Ulitin AB., Yakovenko AR., Mirzabekov TA., Permyakov EA., Permyakov SE. Cancer - Interactions investigated in the context of cancer Glutaraldehyde as cross linker. permyakov.s@gmail.com Biochemical and biophysical research communications 2015 imex curation Only protein-protein interactions s100p_human Protein S100-P S100 calcium-binding protein P S100P S100E Protein S100-E Migration-inducing gene 9 protein protein protein human Homo sapiens Human MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK il11_human Interleukin-11 Adipogenesis inhibitory factor IL11 protein protein human Homo sapiens Human MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) i11ra_human Interleukin-11 receptor subunit alpha IL11RA protein protein human Homo sapiens Human MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAPNL il11-s100p-1 2867991 N/A 2867994 unspecified role unspecified role prey prey n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2867995 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2867996 stimulator stimulator unspecified role unspecified role direct interaction direct interaction false false false 2867991 2867991 1 A/B Data fitted a heterogeneous (two) ligand model with one analyte molecule, which generates two Kd values. il11-il11ra-1 2867991 N/A 2867997 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region_including_ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2867995 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2868009 2868007 direct interaction direct interaction false false false 2867991 2867991 1Ai Data fitted a heterogeneous (two) ligand model with one analyte molecule, which generates two Kd values. il11-s100p-2 2867992 N/A 2867994 unspecified role unspecified role neutral component neutral component n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2867995 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2867996 stimulator stimulator unspecified role unspecified role direct interaction direct interaction false false false 2867992 2A The affinity of S100P to the strongest IL-11 binding site was derived from the 1st stage of the titration curve using the single site binding model. calcium(2+)-il11-1 2867993 N/A 2867994 unspecified role unspecified role neutral component neutral component n_terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 2867995 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 2B Evidence is shown of higher order quaternary structures.