IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ herrero-2015-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Cancer cell 2015 Only protein-protein interactions imex curation imex curation herrero-2015-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Cancer cell 2015 Only protein-protein interactions imex curation imex curation herrero-2015-3 in vitro In vitro bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. GST- MEK1-deltaN-EE was incubated with His-ERK2 plus increasing concentrations of DEL-22379, or DEL-22379 was added after ERK2 had been phosphorylated. Samples were analyzed by native electrophoresis and immunoblotted both before and after HPLC fractionation. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Cancer cell 2015 Only protein-protein interactions imex curation imex curation herrero-2015-4 in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Cancer cell 2015 Only protein-protein interactions imex curation imex curation herrero-2015-5 rat-pac1 PAC1-Rat pulmonary artery smooth muscle cell line Rat pac1 PAC1-Rat pulmonary artery smooth muscle cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Cancer cell 2015 Only protein-protein interactions imex curation imex curation herrero-2015-6 in vitro In vitro chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Cancer cell 2015 Only protein-protein interactions imex curation imex curation herrero-2015-7 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P., Herrero A., Pinto A., Colón-Bolea P., Casar B., Jones M., Agudo-Ibáñez L., Vidal R., Tenbaum SP., Nuciforo P., Valdizán EM., Horvath Z., Orfi L., Pineda-Lucena A., Bony E., Keri G., Rivas G., Pazos A., Gozalbes R., Palmer HG., Hurlstone A., Crespo P. Cancer - Interactions investigated in the context of cancer Results from Kinase assays using MBP as a substrate have not been included as the origins of the MBP used are not stated. Results from the ProQuinase Kinase Inhibition Assay (Supplementary Table 4) have not been included as the "details on the methodology" as given on the ProQuinase website do not include substrates used. Transfected His-tagged ERK/ERK2 has been determined to be of Murine origin by residue and mutation mapping. The authors have confirmed that FLAG and HA tagged ERK2 are of Murine origin. [MEK1 has been detemined to be of Human origin from pmid:1281467 -via Jaaro 1997 reference.] crespop@unican.es Cancer cell 2015 Only protein-protein interactions imex curation imex curation mk01_mouse Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein mouse Mus musculus Mouse MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS max_human Protein max MAX BHLHD4 Class D basic helix-loop-helix protein 4 Myc-associated factor X protein protein human Homo sapiens Human MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA del-22379 DEL-22379 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mapk1-mapk1-1 1886783 N/A 1886790 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1886790 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D EGF -epidermal growth factor DEL-22379 (CHEBI:90905) The estimated IC 50 is ~0.5 uM mapk1-mapk1-4 1886783 N/A 1886791 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1886791 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7D EGF -epidermal growth factor starvation mapk1-mapk1-2 1886784 N/A 1886790 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1886790 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false 1E EGF -epidermal growth factor DEL-22379 (CHEBI:90905) max-myc-13 1886784 N/A 1886792 unspecified role unspecified role neutral component neutral component N/A 1886793 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Supp 1E mapk1-mapk1-3 1886785 N/A 1886790 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P63085:p.[His176Glu;Leu333Ala;Leu336Ala;Leu341Ala;Leu344Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false 1F, 7F, Supp 1A (LHS + RHS), 1F, del_22379-mapk1-1 1886785 N/A 1886794 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1886790 unspecified role unspecified role neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false 1886785 1F, Supp 1 F/G DEL-22379 (CHEBI:90905) DEL-22379 on had no effect pre-existing ERK2 dimers. CHEBI:90905 decreases the dimerisation of P63085 del_22379-mapk1-2 1886786 N/A 1886794 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1886790 unspecified role unspecified role neutral component neutral component P63085:p.His176Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P63085:p.Asp175Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false red_NT_647_dye fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P63085:p.Phe181Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false 2B An ERK2 mutant "F329A" is stated as have been used in this experiment, however there is not an "F" at residue 239, so this mutation has not been entered. mapk1-mapk1-5 1886787 N/A 1886791 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1886791 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7D-2 EGF -epidermal growth factor starvation mapk1-1 1886788 N/A 1886790 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P63085:p.[His176Glu;Leu333Ala;Leu336Ala;Leu341Ala;Leu344Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Supp 1A (middle image) mapk1-mapk1-6 1886789 N/A 1886790 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1886790 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp 1D EGF -epidermal growth factor DEL-22379 (CHEBI:90905)