IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cheung-2014-5 Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer Samples were fractionated using a gel filtration column prior to IP. wcheung@mdanderson.org,gmills@mdanderson.org wcheung@mdanderson.org Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation cheung-2014-1 Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer wcheung@mdanderson.org wcheung@mdanderson.org,gmills@mdanderson.org Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation cheung-2014-2 Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer wcheung@mdanderson.org wcheung@mdanderson.org,gmills@mdanderson.org Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation cheung-2014-6 Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. human-skut2 Human-SK-UT-2 skut2 SK-UT-2 human endometrial grade 3 carcinoma derived cell line No info can be found on this cell line - probably a derivative of SK-UT1 or SK-UT-1B. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer Samples were fractionated using a gel filtration column prior to IP. SKUT2 cells were transfected with HA-tagged NES-PIK3R1R348∗ wcheung@mdanderson.org,gmills@mdanderson.org wcheung@mdanderson.org Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation cheung-2014-4 Naturally Occurring Neomorphic PIK3R1 Mutations Activate the MAPK Pathway, Dictating Therapeutic Response to MAPK Pathway Inhibitors. human-ovk18 Human-OVK18 ovarian endometrioid carcinoma ovk18 OVK18 ovarian endometrioid carcinoma no reference found, but this cell line is listed the Riken Bioresource Centre. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung L.W., Yu S., Zhang D., Li J., Ng P.K., Panupinthu N., Mitra S., Ju Z., Yu Q., Liang H., Hawke D.H., Lu Y., Broaddus R.R., Mills G.B. Cancer - Interactions investigated in the context of cancer PIK3R1 L370fs mutant is a truncation mutant; as confirmed by Editors choice article -Morphin’ Mutant p85α Ref: Sci. Signal., 28 October 2014, Ferrarelli. L. wcheung@mdanderson.org wcheung@mdanderson.org,gmills@mdanderson.org Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation p85a_human Phosphatidylinositol 3-kinase regulatory subunit alpha PIK3R1 GRB1 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha protein protein human Homo sapiens Human MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL mp2k7_human Dual specificity mitogen-activated protein kinase kinase 7 MAPK/ERK kinase 7 JNK-activating kinase 2 c-Jun N-terminal kinase kinase 2 MAP2K7 JNKK2 MKK7 PRKMK7 MEK7 Stress-activated protein kinase kinase 4 SKK4 protein protein human Homo sapiens Human MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR m3k11_human Mitogen-activated protein kinase kinase kinase 11 MAP3K11 Mixed lineage kinase 3 Src-homology 3 domain-containing proline-rich kinase SPRK PTK1 MLK3 protein protein human Homo sapiens Human MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLEEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSREEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKRSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEPGQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPLGSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRDLQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPVGQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP mk08_human Mitogen-activated protein kinase 8 MAPK8 JNK1 PRKM8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 JNK-46 SAPK1 Stress-activated protein kinase 1c SAPK1C protein protein human Homo sapiens Human MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR mk09_human Mitogen-activated protein kinase 9 Stress-activated protein kinase JNK2 c-Jun N-terminal kinase 2 JNK-55 MAPK9 JNK2 PRKM9 Stress-activated protein kinase 1a SAPK1A protein protein human Homo sapiens Human MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR pik3r1-cdc42-12 1763830 n/a 1763835 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1763836 unspecified role unspecified role prey prey n/a 1763837 unspecified role unspecified role prey prey association association false false false Supp 6C/E pik3r1-cdc42-12 1763830 n/a 1763838 unspecified role unspecified role prey prey n/a 1763835 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1763839 unspecified role unspecified role prey prey n/a 1763840 unspecified role unspecified role prey prey n/a 1763837 unspecified role unspecified role prey prey n/a 1763841 unspecified role unspecified role prey prey n/a 1763836 unspecified role unspecified role prey prey association association false false false 6D fractions 25-29, 6E Supp 6 D/E The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced nuclear complex formation, but not cytosolic complex formation. Supp fig 6C; this interaction was only detected in lane 29. pik3r1-cdc42-5 1763831 n/a 1763836 unspecified role unspecified role prey prey n/a 1763837 unspecified role unspecified role prey prey n/a 1763835 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5A pik3r1-cdc42-9 1763831 n/a 1763839 unspecified role unspecified role prey prey n/a 1763838 unspecified role unspecified role prey prey n/a 1763840 unspecified role unspecified role prey prey n/a 1763841 unspecified role unspecified role prey prey n/a 1763836 unspecified role unspecified role prey prey n/a 1763837 unspecified role unspecified role prey prey n/a 1763835 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6A The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced nuclear complex formation, but not cytosolic complex formation. mapk8-cdc42 1763832 n/a 1763840 unspecified role unspecified role bait bait n/a 1763841 unspecified role unspecified role prey prey n/a 1763835 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1763838 unspecified role unspecified role prey prey n/a 1763837 unspecified role unspecified role prey prey n/a 1763839 unspecified role unspecified role prey prey n/a 1763836 unspecified role unspecified role prey prey association association false false false 6B The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced the number of interactors in this nuclear complex. WT p85a. A nuclear export signal fused to the N-terminus of the p85a R348* mutant. mapk8-pik3r1-1 1763832 n/a 1763840 unspecified role unspecified role bait bait n/a 1763838 unspecified role unspecified role prey prey n/a 1763839 unspecified role unspecified role prey prey association association false false false 6B The presence of WT p85a or a nuclear export signal fused to the N-terminus of the p85a R348* mutant reduced the number of interactors in this nuclear complex. mapk8-pik3r1-3 1763833 n/a 1763840 unspecified role unspecified role bait bait n/a 1763839 unspecified role unspecified role prey prey n/a 1763838 unspecified role unspecified role prey prey association association false false false 6F pik3r1-cdc42-13 1763834 n/a 1763837 unspecified role unspecified role prey prey n/a 1763835 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1763838 unspecified role unspecified role prey prey n/a 1763841 unspecified role unspecified role prey prey n/a 1763836 unspecified role unspecified role prey prey n/a 1763839 unspecified role unspecified role prey prey n/a 1763840 unspecified role unspecified role prey prey association association false false false Supp 6A