IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shi-2014a-7 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-2 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-6 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-4 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. human-bt_549 Homo sapiens BT_549 Breast ductal carcinoma cell line bt_549 BT 549 Human Breast ductal carcinoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-5 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. human-sum1315 Human 1315- metastatic/invasive breast ductal carcinoma cell line sum1315 Human SUM1315- metastatic/invasive breast ductal carcinoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-12 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-3 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. in vitro In vitro acetylase assay acetylase assay western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-1 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. in vitro In vitro acetylase assay acetylase assay sequence tag sequence tag identification sequence tag Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-8 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-9 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation shi-2014a-10 Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer. human-sum1315 Human 1315- metastatic/invasive breast ductal carcinoma cell line sum1315 Human SUM1315- metastatic/invasive breast ductal carcinoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi J., Wang Y., Zeng L., Wu Y., Deng J., Zhang Q., Lin Y., Li J., Kang T., Tao M., Rusinova E., Zhang G., Wang C., Zhu H., Yao J., Zeng Y.X., Evers B.M., Zhou M.M., Zhou B.P. Cancer - Interactions investigated in the context of cancer HA-Twist has been entered as Human Twist1 based on the length of the molecule shown in figure 2A (202 amino acids.) Flag-BRD4 has been entered as Human based on the molecule shown in figure 1D (1362 amino acids). The authors did not reply to a request to confirm this. Results obtained using antibodies to H3K27ac have not been included due to lack of antibody specificity. Similarly results obtained using antibodies to Pol2 have not been included (ChIPs and IPs) as the identity of the molecule(s) targeted is not known. Results from Fluorescence Anisotropy experiments (Supplementary Figs 1I and some of 4B) have not been included as the authors have not responded to a request to clarify the experimental protocol. IP results using an anti-Twist antibody have not been included due to lack of antibody specificity. Results obtained using HA-Tip60 have not been included as the origin of this molecule is not stated. peter.zhou@uky.edu,ming-ming.zhou@mssm.edu Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH o60885-1 Bromodomain-containing protein 4 Brd4L Long BRD4 HUNK1 Protein HUNK1 protein protein human Homo sapiens Human MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG cdk9_human Cyclin-dependent kinase 9 CDK9 CDC2L4 Cell division protein kinase 9 Serine/threonine-protein kinase PITALRE Cell division cycle 2-like protein kinase 4 C-2K TAK Tat-associated kinase complex catalytic subunit protein protein human Homo sapiens Human MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF brd4_human Bromodomain-containing protein 4 Protein HUNK1 BRD4 HUNK1 protein protein human Homo sapiens Human MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF wnt5a_human_gene WNT5A_HUMAN_GENE gene gene human Homo sapiens Human kat5_human Histone acetyltransferase KAT5 KAT5 TIP60 HTATIP Lysine acetyltransferase 5 cPLA(2)-interacting protein Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein human Homo sapiens Human MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW twist1-brd4 1511351 n/a 1511362 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q15672:p.Lys73Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q15672:p.Lys76Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false 15-30 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511363 unspecified role unspecified role prey prey O60885-1:p.Asp144His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false O60885-1:p.His437Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false bd2_domain required to bind necessary binding region required to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A/D/E/F, 2A/F/G, 4C Trichostatin (TSA) - a histone deacetylase inhibitor. Mutation of the conserved tyrosine and asparagine residues in the acetyllysine binding pocket of BD2 to alanine (BD2YN) reduced its binding to Twist. JQ1, a BET-specific bromodomain inhibitor brd4-twist1-1 1511351 n/a 1511363 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bd2_domain required to bind necessary binding region required to bind range range range range false O60885-1:p.Asp144His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false O60885-1:p.His437Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false n/a 1511362 unspecified role unspecified role prey prey Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q15672:p.Lys73Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q15672:p.Lys76Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A-2/D/E/F, 2A/F/G, 4C Trichostatin (TSA) - a histone deacetylase inhibitor. Mutation of the conserved tyrosine and asparagine residues in the acetyllysine binding pocket of BD2 to alanine (BD2YN) reduced its binding to Twist. JQ1, a BET-specific bromodomain inhibitor twist1-brd4-6 1511351 n/a 1511363 unspecified role unspecified role prey prey bd1+2_domain required to bind necessary binding region required to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511364 unspecified role unspecified role prey prey possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511362 unspecified role unspecified role bait bait possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false association association false false false 4D Trichostatin (TSA) - a histone deacetylase inhibitor. brd4-hist1h4a 1511351 n/a 1511363 unspecified role unspecified role bait bait bd2_domain required to bind necessary binding region required to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511364 unspecified role unspecified role prey prey possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511362 unspecified role unspecified role prey prey possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4Di Trichostatin (TSA) - a histone deacetylase inhibitor. brd4-hist1h4a-1 1511351 n/a 1511364 unspecified role unspecified role prey prey possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511363 unspecified role unspecified role bait bait bd1_domain required to bind necessary binding region required to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4Dii Trichostatin (TSA) - a histone deacetylase inhibitor. twist1-brd4-7 1511351 n/a 1511362 unspecified role unspecified role bait bait possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1511363 unspecified role unspecified role prey prey bd2_domain required to bind necessary binding region required to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4D-2 Trichostatin (TSA) - a histone deacetylase inhibitor. twist1-brd4-9 1511351 n/a 1511365 unspecified role unspecified role prey prey n/a 1511362 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511363 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6E RNA polymerase 2 was also detected in this complex, but the interacting subunit has not been identified. hist1h4a-brd4-5 1511352 n/a 1511364 unspecified role unspecified role bait bait lys9 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false lys6 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511363 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 3B-A twist1-brd4-11 1511352 n/a 1511362 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511363 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 3Bi-A twist1-brd4-12 1511352 n/a 1511364 competitor competitor competitor prey prey lys9 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain false lys6 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511362 unspecified role unspecified role bait bait lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511363 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 3Bi hist1h4a-brd4-6 1511352 n/a 1511362 competitor competitor competitor prey prey lys6 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain false lys9 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511363 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1511364 unspecified role unspecified role bait bait lys9 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false lys6 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 3B hist1h4a-brd4-2 1511352 n/a 1511364 unspecified role unspecified role bait bait lys9 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false lys6 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511364 competitor competitor competitor prey prey lys6 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain false lys9 naccys N-acetyl-L-cysteine (2R)-2-acetamido-3-sulfanylpropanoic acid 2-acetylamino-3-mercaptopropanoic acid 2-acetylamino-3-sulfanylpropanoic acid 2-acetylazanyl-3-sulfanylpropanoic acid MOD_RES N-acetylcysteine N-acetyl-L-cysteine N-acetylated cysteine N-acetylcysteine Acetyl NAcCys certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511363 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 3B-a twist1-brd4-4 1511352 n/a 1511362 competitor competitor competitor prey prey lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511362 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511363 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 3Bi brd4-twist1-3 1511353 n/a 1511366 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511362 unspecified role unspecified role neutral component neutral component lys73 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-2 brd4-twist1-4 1511353 n/a 1511362 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511366 unspecified role unspecified role neutral component neutral component bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-3 brd4-twist1-5 1511353 n/a 1511366 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1511362 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-4 brd4-twist1 1511353 n/a 1511362 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false diacetylated_lys73,lys76 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1511366 unspecified role unspecified role neutral component neutral component bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BRD4-BD2 exhibited substantially the most extended chemical shift perturbations upon binding to the diacetylated Twist peptides. Supp 4A-1 brd4-wnt5a 1511354 n/a 1511366 unspecified role unspecified role bait bait n/a 1511367 unspecified role unspecified role prey prey association association false false false Figure 6 B/C brd4-wnt5a-1 1511354 n/a 1511367 unspecified role unspecified role prey prey n/a 1511364 unspecified role unspecified role bait bait lys6,lys9,lys13,lys17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false association association false false false Figure 6 B/Ci brd4-wnt5a-2 1511354 n/a 1511365 unspecified role unspecified role bait bait n/a 1511367 unspecified role unspecified role prey prey association association false false false Figure 6 B brd4-wnt5a-3 1511355 n/a 1511365 unspecified role unspecified role bait bait n/a 1511367 unspecified role unspecified role prey prey association association false false false Figure 6 B/D, Supp 6D JQ1- a competitive inhibitor of BET proteins (including BRD4) TNFalpha or EGF/insulin brd4-wnt5a-3 1511355 n/a 1511367 unspecified role unspecified role prey prey n/a 1511366 unspecified role unspecified role bait bait association association false false false Figure 6 B/C/D, Supp 6D/E JQ1- a competitive inhibitor of BET proteins (including BRD4) Knockdown of Twist TNFalpha or EGF/insulin brd4-wnt5a-3 1511355 n/a 1511364 unspecified role unspecified role bait bait lys6,lys9,lys13,lys17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1511367 unspecified role unspecified role prey prey association association false false false Figure 6 B/Ci, Supp 6D JQ1- a competitive inhibitor of BET proteins (including BRD4) TNFalpha or EGF/insulin hist1h4a-brd4-3 1511356 n/a 1511363 unspecified role unspecified role prey prey bd1+bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511362 unspecified role unspecified role prey prey Q15672:p.[Lys73Arg;Lys76Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false possible_acetyl_73/76_lys naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511364 unspecified role unspecified role bait bait possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4Diii Trichostatin (TSA) - a histone deacetylase inhibitor. hist1h4a-brd4-4 1511356 n/a 1511363 unspecified role unspecified role prey prey bd2_domain sufficient to bind sufficient binding region sufficient to bind range range range range false bd1_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511364 unspecified role unspecified role bait bait possible_acres naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4Div Trichostatin (TSA) - a histone deacetylase inhibitor. kat5-twist1-1 1511357 n/a 1511368 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1511362 enzyme target enzyme target substrate substrate neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. acetylation acetylation reaction acetylation false false false 3E Q15672 lys-73 N-acetylated L-Lysine Q15672 lys-76 N-acetylated L-Lysine kat5-twist1-2 1511357 n/a 1511364 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1511368 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection acetylation acetylation reaction acetylation false false false 3Ei P62805 lys-6 N-acetylated L-Lysine P62805 lys-9 N-acetylated L-Lysine kat5-twist1 1511358 n/a 1511362 enzyme target enzyme target substrate substrate neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1511368 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection acetylation acetylation reaction acetylation false false false 2H Q15672 lys-73 N-acetylated L-Lysine Q15672 lys-76 N-acetylated L-Lysine twist1-brd4-2 1511359 n/a 1511362 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511366 unspecified role unspecified role prey prey physical association physical association false false false 1B Trichostatin (TSA) - a histone deacetylase inhibitor. brd4-twist1-2 1511360 n/a 1511362 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511366 unspecified role unspecified role bait bait physical association physical association false false false 1B Trichostatin (TSA) - a histone deacetylase inhibitor. twist1-brd4-10 1511361 n/a 1511366 unspecified role unspecified role prey prey n/a 1511365 unspecified role unspecified role prey prey n/a 1511362 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6Ei RNA polymerase 2 was also detected in this complex, but the interacting subunit has not been identified.