IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jiao-2014-2 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer Participant detection is stated to be by "Coomassie blue staining OR western blot." TEAD4 is stated to be of Human origin-quote:-"According to the structural analysis, we designed a series of mutations based on human VGLL4 and TEAD4 to probe and disturb the complex interface (Figure S3F). In vitro biolayer interferometry (BLI) and pull-down assays were subsequently performed to assess the importance of individual amino acids on the interface (Figures 3D and 3E). VGLL4 has been entered as Human, as used in figure 4F, due to mutation mapping. MBP-YAP has also been entered as Human, as (Figure 2I) this is the only species mentioned for this protein throughout this publication. GST-TEAD has also been entered as being of Human origin, as this is stated in Figure 2I, although murine proteins are used elsewhere in this publication hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation jiao-2014-5 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. human-mgc-803 Homo sapiens mgc-803 Human-poorly differentiated human gastric adenocarcinoma MGC803 Original paper: - no pmid available. K.H. Wang The establishment and biological characteristics of a poorly differentiated human gastric adenocarcinoma MGC803 cell line. Acta Biol. Exp. Sin., 16 (1983), pp. 257–267 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation jiao-2014-1 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer For VGLL4 mutants, values obtained of less than 50% of WT maximal response, have been entered as a "decreasing or disrupting mutation". TEAD4 is stated to be of Human origin-quote:-"According to the structural analysis, we designed a series of mutations based on human VGLL4 and TEAD4 to probe and disturb the complex interface (Figure S3F). In vitro biolayer interferometry (BLI) and pull-down assays were subsequently performed to assess the importance of individual amino acids on the interface (Figures 3D and 3E). It has been assumed that for constructs used in Figure 4 BLI assay the same species of origin were used. hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation jiao-2014-4 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. human-mgc-803 Homo sapiens mgc-803 Human-poorly differentiated human gastric adenocarcinoma MGC803 Original paper: - no pmid available. K.H. Wang The establishment and biological characteristics of a poorly differentiated human gastric adenocarcinoma MGC803 cell line. Acta Biol. Exp. Sin., 16 (1983), pp. 257–267 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation jiao-2014-3 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer NO cell line given is given figure Figure 3G in this publication. The Supplement Methods section states:- "Immunoblotting and immunoprecipitation were performed as described previously (Shi et al., 2013)." The only cell line mentioned for IP in Shi et al., is HEK293T, so this has been entered here. hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation jiao-2014-6 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation jiao-2014-7 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation jiao-2014-8 A Peptide Mimicking VGLL4 Function Acts as a YAP Antagonist Therapy against Gastric Cancer. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jiao S., Wang H., Shi Z., Dong A., Zhang W., Song X., He F., Wang Y., Zhang Z., Wang W., Wang X., Guo T., Li P., Zhao Y., Ji H., Zhang L., Zhou Z. Cancer - Interactions investigated in the context of cancer hbji@sibcb.ac.cn,rayzhang@sibcb.ac.cn,zczhou@sibcbac.cn Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation vgll4_human Transcription cofactor vestigial-like protein 4 VGLL4 KIAA0121 protein protein human Homo sapiens Human METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS tead4_human Transcriptional enhancer factor TEF-3 TEAD4 RTEF1 TCF13L1 TEF3 TEA domain family member 4 Transcription factor RTEF-1 Transcription factor 13-like 1 protein protein human Homo sapiens Human MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE vgll4_mouse Transcription cofactor vestigial-like protein 4 Vgll4 protein protein mouse Mus musculus Mouse MLFMKMDLLNYQYLDKMNNNIGVLCYEGEASLRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDKDLDCENDHVSKMSRIFSPHLNKTVNGDCRRDPRERSRSPIERAAAPAVSLHGGHLYASLPSLMEQPLALTKNSSDTGRSAVERQQNRPSVITCASAGARNCNLSHCPIAHSGCSAPGSASYRRPPSATATCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDSASSSPESASRRGQPASPTAHMVSHSHSPSVVS yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL tead4_mouse Transcriptional enhancer factor TEF-3 Tead4 Tcf13r1 Tef3 Tefr1 ETF-related factor 2 TEA domain family member 4 TEF-1-related factor 1 TEF-1-related factor FR-19 protein protein mouse Mus musculus Mouse MTSNEWSSPDSPEGSSISGGSQALDKPIDNDAEGVWSPEIERSFQEALAIYPPCGRRKIILTEEGKMYGRNELIARHIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGYPAISGFWQGALPGQPGTSHDVKPFSQNTYPVQPPLPLPGFESPAGPTPSPSAPLAPPWQGRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE super_tdu Super_tdu-YAP1-VGLL4 fusion protein peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE alanine (Lys-Ala-Leu-Gly) was mutated to serine (Lys-Ser-Leu-Gly) for better solubility ctgf_human_gene CTGF_HUMAN_GENE gene gene human Homo sapiens Human cdx2_human_gene CDX2_HUMAN_GENE gene gene human Homo sapiens Human tead4-vgll4-2 1500882 n/a 1500890 unspecified role unspecified role prey prey Q14135:p.Trp249Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q14135:p.Leu245Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q14135:p.His240Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500891 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 3E tead4-vgll4-4 1500882 n/a 1500892 unspecified role unspecified role prey prey purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1500891 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4E tead4-vgll4-7 1500882 n/a 1500893 competitor competitor competitor prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500891 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500892 unspecified role unspecified role prey prey purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false 4Ei tead4-vgll4-8 1500882 n/a 1500891 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500892 competitor competitor competitor prey prey purified purified tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500893 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false 4Eii (RHS) tead4-vgll4-9 1500882 n/a 1500891 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500893 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4Eiii (RHS) yap1-tead4 1500882 n/a 1500893 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500894 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1500890 competitor competitor competitor prey prey purified purified Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false 4F tead4-super 1500882 n/a 1500895 unspecified role unspecified role prey prey super_tdu:p.[His5_Phe6delinsAlaAla;Met34Ala;Phe43Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false super_tdu:p.[Met34Ala;Phe43Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1500891 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp 4C The Experimental Proceedures section does not specify which of the two phenlyalanines is mutated in the MF2A mutant. super-tead4 1500882 n/a 1500891 unspecified role unspecified role prey prey human-mgc-803 Homo sapiens mgc-803 Human-poorly differentiated human gastric adenocarcinoma MGC803 Original paper: - no pmid available. K.H. Wang The establishment and biological characteristics of a poorly differentiated human gastric adenocarcinoma MGC803 cell line. Acta Biol. Exp. Sin., 16 (1983), pp. 257–267 n/a 1500895 unspecified role unspecified role bait bait n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 5K yap1-tead4-2 1500883 n/a 1500896 unspecified role unspecified role prey prey n/a 1500893 unspecified role unspecified role bait bait association association false false false 5F yap1-super-1 1500883 n/a 1500893 unspecified role unspecified role bait bait n/a 1500895 competitor competitor competitor prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1500896 unspecified role unspecified role prey prey association association false false false 5Fi Super_tdu decreases expression at RNA level of ENSG00000118523 yap1-ctgf 1500883 n/a 1500897 unspecified role unspecified role prey prey n/a 1500893 unspecified role unspecified role bait bait association association false false false 5Fii yap1-ctgf-1 1500883 n/a 1500897 unspecified role unspecified role prey prey n/a 1500895 competitor competitor competitor prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1500893 unspecified role unspecified role bait bait association association false false false 5Fiv Super_tdu decreases expression at RNA level of ENSG00000165556 tead4-vgll4-1 1500884 n/a 1500891 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1500890 unspecified role unspecified role prey prey Q14135:p.His240Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q14135:p.Leu245Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1500884 3D, 4G tead4-vgll4-10 1500884 n/a 1500891 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1500893 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1500884 4G yap1-tead4-1 1500885 n/a 1500891 unspecified role unspecified role prey prey n/a 1500893 unspecified role unspecified role bait bait physical association physical association false false false 5B yap1-super 1500885 n/a 1500895 competitor competitor competitor prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1500893 unspecified role unspecified role bait bait n/a 1500891 unspecified role unspecified role prey prey association association false false false 5Bi tead4-vgll4-3 1500886 n/a 1500890 unspecified role unspecified role prey prey Q14135:p.His240_Phe241delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q14135:p.[His212_Phe213delinsAlaAla;His240_Phe241delinsAlaAla] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1500891 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3G tead4-vgll4-12 1500887 n/a 1500894 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yap_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1500892 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 1501018 1501015 direct interaction direct interaction false false false Supp 3A tead4-vgll4-13 1500888 n/a 1500894 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yap_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1500892 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 1501025 1501022 direct interaction direct interaction false false false Supp 3B tead4-vgll4-14 1500889 n/a 1500894 unspecified role unspecified role neutral component neutral component yap_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1500892 unspecified role unspecified role neutral component neutral component tandem_tdu_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 1501031 1501028 direct interaction direct interaction false false false Supp 3C-E, Supp table 6. 2.9A Rwork = 0.19 Rfree = 0.25 The Tandem TDU region of VGLL4 forms an intermolecular beta-sheet with two TEAD4 molecules; VGLL4 -TDU1 and TDU2 appear to function as individual binding units for separate TEADs molecules.