IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ thorsen-2013-1 Plasma levels of the MMP-9:TIMP-1 complex as prognostic biomarker in breast cancer: a retrospective study. human-plasma homo sapiens blood plasma plasma blood plasma elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Thorsen S.B., Christensen S.L., Würtz S.O., Lundberg M., Nielsen B.S., Vinther L., Knowles M., Gee N., Fredriksson S., Møller S., Brünner N., Schrohl A.S., Stenvang J. Cancer - Interactions investigated in the context of cancer Plasma from 465 preoperative patients with primary breast cancer stenvang@sund.ku.dk BMC Cancer 2013 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. thorsen-2013-2 Plasma levels of the MMP-9:TIMP-1 complex as prognostic biomarker in breast cancer: a retrospective study. human-plasma homo sapiens blood plasma plasma blood plasma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Thorsen S.B., Christensen S.L., Würtz S.O., Lundberg M., Nielsen B.S., Vinther L., Knowles M., Gee N., Fredriksson S., Møller S., Brünner N., Schrohl A.S., Stenvang J. Cancer - Interactions investigated in the context of cancer Experiments were also carried out using recombinant MMP9 (CHO cell derived aas 20-707) and recombinant TIMP1 (expression system used is unclear) to help validate/standardise the assay protocol; however no results are shown for these assays. "In-solution" PLA using plasma from 465 preoperative patients with primary breast cancer. stenvang@sund.ku.dk BMC Cancer 2013 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. mmp9_human Matrix metalloproteinase-9 MMP9 CLG4B 92 kDa type IV collagenase 92 kDa gelatinase Gelatinase B protein protein human Homo sapiens Human MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED timp1_human Metalloproteinase inhibitor 1 Tissue inhibitor of metalloproteinases 1 Erythroid-potentiating activity Fibroblast collagenase inhibitor TIMP1 CLGI TIMP protein protein human Homo sapiens Human MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA mmp9-timp1-2 1572681 n/a 1572683 unspecified role unspecified role bait bait n/a 1572684 unspecified role unspecified role prey prey proximity proximity close-contact colocalization neighbourhood interaction false false false 4A, Additional File 2 (fig 2) mmp9-timp1-1 1572682 n/a 1572683 unspecified role unspecified role neutral component neutral component n/a 1572684 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 3, 4B, Add. file 2