Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com cao-2013-1 Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1. human-bel-7402 Human BEL-7402 Hepatoma cell line bel-7402 BEL-7402 Human Hepatoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cao X., Zhang L., Shi Y., Sun Y., Dai S., Guo C., Zhu F., Wang Q., Wang J., Wang X., Chen Y.H., Zhang L. Cancer - Interactions investigated in the context of cancer Details on mutations in TIPE2 affecting the binding are not curated as it is not clear from the article if mutations at Lys15, Lys16 and Arg24 are individual mutations or complex mutations. zhanglining@s du.edu.cn zhanglining@sdu.edu.cn Mol. Cancer 2013 imex curation Molecular Connections Pvt. ltd. Only protein-protein interactions cao-2013-2 Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1. human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cao X., Zhang L., Shi Y., Sun Y., Dai S., Guo C., Zhu F., Wang Q., Wang J., Wang X., Chen Y.H., Zhang L. Cancer - Interactions investigated in the context of cancer zhanglining@s du.edu.cn zhanglining@sdu.edu.cn Mol. Cancer 2013 imex curation Molecular Connections Pvt. ltd. Only protein-protein interactions tp8l2_human Tumor necrosis factor alpha-induced protein 8-like protein 2 TNFAIP8L2 Inflammation factor protein 20 protein protein human Homo sapiens Human MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL tnfaip8l2-rac1 1474763 n/a 1474765 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false The mutant TNFAIP8L2 in which the N-terminal Lys or Arg residues, Lys-15, Lys-16, and Arg-24 are replaced with Glu or Ala fail to bind. n/a 1474766 unspecified role unspecified role prey prey physical association physical association false false false 4b rac1-tnfaip8l2 1474764 n/a 1474766 unspecified role unspecified role bait bait n/a 1474765 unspecified role unspecified role prey prey physical association physical association false false false s4b