IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bender-2013-1 Reduced H3K27me3 and DNA Hypomethylation Are Major Drivers of Gene Expression in K27M Mutant Pediatric High-Grade Gliomas. human-sf188 Human SF-188 Glioma/Astrocytoma/glioblastoma multiforme Paediatric cell line sf188 SF-188 Glioma/Astrocytoma/glioblastoma multiforme Paediatric cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bender S., Tang Y., Lindroth A.M., Hovestadt V., Jones D.T., Kool M., Zapatka M., Northcott P.A., Sturm D., Wang W., Radlwimmer B., Højfeldt J.W., Truffaux N., Castel D., Schubert S., Ryzhova M., Seker-Cin H., Gronych J., Johann P.D., Stark S., Meyer J., Milde T., Schuhmann M., Ebinger M., Monoranu C.M., Ponnuswami A., Chen S., Jones C., Witt O., Collins V.P., von Deimling A., Jabado N., Puget S., Grill J., Helin K., Korshunov A., Lichter P., Monje M., Plass C., Cho Y.J., Pfister S.M. Cancer - Interactions investigated in the context of cancer The authors have confirmed that HA-tagged H3.3 (WT, K27M) constructs are Human in origin. c.plass@dkfz.de,yjcho1@stanford.edu,s.pfister@dkfz.de Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation bender-2013-3 Reduced H3K27me3 and DNA Hypomethylation Are Major Drivers of Gene Expression in K27M Mutant Pediatric High-Grade Gliomas. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bender S., Tang Y., Lindroth A.M., Hovestadt V., Jones D.T., Kool M., Zapatka M., Northcott P.A., Sturm D., Wang W., Radlwimmer B., Højfeldt J.W., Truffaux N., Castel D., Schubert S., Ryzhova M., Seker-Cin H., Gronych J., Johann P.D., Stark S., Meyer J., Milde T., Schuhmann M., Ebinger M., Monoranu C.M., Ponnuswami A., Chen S., Jones C., Witt O., Collins V.P., von Deimling A., Jabado N., Puget S., Grill J., Helin K., Korshunov A., Lichter P., Monje M., Plass C., Cho Y.J., Pfister S.M. Cancer - Interactions investigated in the context of cancer The authors have confirmed that HA-tagged H3.3 (WT, K27M) constructs are Human in origin. c.plass@dkfz.de,yjcho1@stanford.edu,s.pfister@dkfz.de Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation bender-2013-2 Reduced H3K27me3 and DNA Hypomethylation Are Major Drivers of Gene Expression in K27M Mutant Pediatric High-Grade Gliomas. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bender S., Tang Y., Lindroth A.M., Hovestadt V., Jones D.T., Kool M., Zapatka M., Northcott P.A., Sturm D., Wang W., Radlwimmer B., Højfeldt J.W., Truffaux N., Castel D., Schubert S., Ryzhova M., Seker-Cin H., Gronych J., Johann P.D., Stark S., Meyer J., Milde T., Schuhmann M., Ebinger M., Monoranu C.M., Ponnuswami A., Chen S., Jones C., Witt O., Collins V.P., von Deimling A., Jabado N., Puget S., Grill J., Helin K., Korshunov A., Lichter P., Monje M., Plass C., Cho Y.J., Pfister S.M. Cancer - Interactions investigated in the context of cancer The authors have confirmed that HA-tagged H3.3 (WT, K27M) constructs are Human in origin. c.plass@dkfz.de,yjcho1@stanford.edu,s.pfister@dkfz.de Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation bender-2013-4 Reduced H3K27me3 and DNA Hypomethylation Are Major Drivers of Gene Expression in K27M Mutant Pediatric High-Grade Gliomas. human-sf188 Human SF-188 Glioma/Astrocytoma/glioblastoma multiforme Paediatric cell line sf188 SF-188 Glioma/Astrocytoma/glioblastoma multiforme Paediatric cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bender S., Tang Y., Lindroth A.M., Hovestadt V., Jones D.T., Kool M., Zapatka M., Northcott P.A., Sturm D., Wang W., Radlwimmer B., Højfeldt J.W., Truffaux N., Castel D., Schubert S., Ryzhova M., Seker-Cin H., Gronych J., Johann P.D., Stark S., Meyer J., Milde T., Schuhmann M., Ebinger M., Monoranu C.M., Ponnuswami A., Chen S., Jones C., Witt O., Collins V.P., von Deimling A., Jabado N., Puget S., Grill J., Helin K., Korshunov A., Lichter P., Monje M., Plass C., Cho Y.J., Pfister S.M. Cancer - Interactions investigated in the context of cancer The authors have confirmed that HA-tagged H3.3 (WT, K27M) constructs are Human in origin. c.plass@dkfz.de,yjcho1@stanford.edu,s.pfister@dkfz.de Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation bender-2013-5 Reduced H3K27me3 and DNA Hypomethylation Are Major Drivers of Gene Expression in K27M Mutant Pediatric High-Grade Gliomas. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bender S., Tang Y., Lindroth A.M., Hovestadt V., Jones D.T., Kool M., Zapatka M., Northcott P.A., Sturm D., Wang W., Radlwimmer B., Højfeldt J.W., Truffaux N., Castel D., Schubert S., Ryzhova M., Seker-Cin H., Gronych J., Johann P.D., Stark S., Meyer J., Milde T., Schuhmann M., Ebinger M., Monoranu C.M., Ponnuswami A., Chen S., Jones C., Witt O., Collins V.P., von Deimling A., Jabado N., Puget S., Grill J., Helin K., Korshunov A., Lichter P., Monje M., Plass C., Cho Y.J., Pfister S.M. Cancer - Interactions investigated in the context of cancer The authors have confirmed that HA-tagged H3.3 (WT, K27M) constructs are Human in origin. c.plass@dkfz.de,yjcho1@stanford.edu,s.pfister@dkfz.de Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation bender-2013-6 Reduced H3K27me3 and DNA Hypomethylation Are Major Drivers of Gene Expression in K27M Mutant Pediatric High-Grade Gliomas. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bender S., Tang Y., Lindroth A.M., Hovestadt V., Jones D.T., Kool M., Zapatka M., Northcott P.A., Sturm D., Wang W., Radlwimmer B., Højfeldt J.W., Truffaux N., Castel D., Schubert S., Ryzhova M., Seker-Cin H., Gronych J., Johann P.D., Stark S., Meyer J., Milde T., Schuhmann M., Ebinger M., Monoranu C.M., Ponnuswami A., Chen S., Jones C., Witt O., Collins V.P., von Deimling A., Jabado N., Puget S., Grill J., Helin K., Korshunov A., Lichter P., Monje M., Plass C., Cho Y.J., Pfister S.M. Cancer - Interactions investigated in the context of cancer The authors have confirmed that HA-tagged H3.3 (WT, K27M) constructs are Human in origin. c.plass@dkfz.de,yjcho1@stanford.edu,s.pfister@dkfz.de Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h3f3a-ezh2 1463839 n/a 1463845 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P84243:p.Lys28Met mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false n/a 1463846 unspecified role unspecified role prey prey n/a 1463847 unspecified role unspecified role prey prey association association false false false 2C, Supp 1B. EZH2 as well as SUZ12 was dramatically enriched in immunoprecipitated K27M-containing mono-nucleosomes relative to wild-type H3.3 protein. h3f3a-ezh2-3 1463839 n/a 1463845 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1463848 unspecified role unspecified role prey prey physical association physical association false false false 2B h3f3a-ezh2-1 1463840 n/a 1463847 unspecified role unspecified role prey prey n/a 1463846 unspecified role unspecified role prey prey n/a 1463845 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P84243:p.Lys28Met mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false association association false false false 2C, Supp1B. EZH2 as well as SUZ12 was dramatically enriched in immunoprecipitated K27M-containing mono-nucleosomes relative to wild-type H3.3 protein. h3f3a-hist1h4a-1 1463840 n/a 1463848 unspecified role unspecified role prey prey n/a 1463845 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2B h3f3a-ezh2-2 1463841 n/a 1463845 unspecified role unspecified role bait bait P84243:p.Lys28Met mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1463846 unspecified role unspecified role prey prey n/a 1463847 unspecified role unspecified role prey prey association association false false false 2C, Supp 1B. EZH2 as well as SUZ12 was dramatically enriched in immunoprecipitated K27M-containing mono-nucleosomes relative to wild-type H3.3 protein. h3f3a-hist1h4a 1463841 n/a 1463845 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1463848 unspecified role unspecified role prey prey physical association physical association false false false 2B ezh2-h3f3a 1463842 n/a 1463846 unspecified role unspecified role prey prey n/a 1463845 unspecified role unspecified role prey prey P84243:p.Lys28Met mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1463847 unspecified role unspecified role bait bait association association false false false 2D The exogenous K27M mutant H3.3 was enriched compared with the exogenous wild-type H3.3 protein. ezh2-h3f3a-1 1463843 n/a 1463847 unspecified role unspecified role bait bait n/a 1463845 unspecified role unspecified role prey prey P84243:p.Lys28Met mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1463846 unspecified role unspecified role prey prey association association false false false 2D The exogenous K27M mutant H3.3 was enriched compared with the exogenous wild-type H3.3 protein. ezh2-h3f3a-2 1463844 n/a 1463845 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P84243:p.Lys28Met mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false n/a 1463846 unspecified role unspecified role prey prey n/a 1463847 unspecified role unspecified role bait bait association association false false false 2D The exogenous K27M mutant H3.3 was enriched compared with the exogenous wild-type H3.3 protein.