Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com azad-2013-2 BAK multimerization for apoptosis, but not bid binding, is inhibited by negatively charged residue in the BAK hydrophobic groove. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Azad A., Storey A. Cancer - Interactions investigated in the context of cancer astorey6 2@gmail.com astorey62@gmail.com Cross-linking reactions performed with 6-bismaleimidohexane or Bismaleimidoethane. Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. azad-2013-1 BAK multimerization for apoptosis, but not bid binding, is inhibited by negatively charged residue in the BAK hydrophobic groove. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Azad A., Storey A. Cancer - Interactions investigated in the context of cancer astorey6 2@gmail.com astorey62@gmail.com Mol. Cancer 2013 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD bak1-bak1-1 1469322 n/a 1469324 unspecified role unspecified role neutral component neutral component Q16611:p.Tyr110Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1469324 unspecified role unspecified role neutral component neutral component Q16611:p.Tyr110Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false HCT116 BAK/BAX double knock out cells reconstituted to express BAK. BAX dimers and multimers are formed in response to DNA damage. 1b, 1c. Etoposide and UV radiation Using X-Linker 1, 6-bismaleimidohexane (BMH), trimers and higher order complexes were seen. bak1-bak1-2 1469322 n/a 1469324 unspecified role unspecified role neutral component neutral component Q16611:p.Tyr110Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false HCT116 BAK/BAX double knock out cells reconstituted to express BAK. BAX dimers and multimers are formed in response to DNA damage. 1b, 1c. Etoposide and UV radiation Using BMOE (Bismaleimidoethane) only dimers were seen. bid-bak1-4 1469323 n/a 1469324 unspecified role unspecified role prey prey Q16611:p.Tyr110Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1469325 unspecified role unspecified role bait bait physical association physical association false false false 3b,c