IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ arteaga-2013-5 The Histone Demethylase PHF8 Governs Retinoic Acid Response in Acute Promyelocytic Leukemia. human-nb4-mr2 NB4-MR2-an NB4-derived ATRA-resistant cell line nb4-mr2 NB4-MR2-an NB4-derived ATRA-resistant cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Arteaga M.F., Mikesch J.H., Qiu J., Christensen J., Helin K., Kogan S.C., Dong S., So C.W. Cancer - Interactions investigated in the context of cancer Cells were cells transduced with Human PHF8 (entered as isoform-2 to give the correct mutation numbering). Interactions involving Histone H3 have not been included due to lack of antibody specificity. Interactions involving the STAT5-RARa fusion protein have also not been entered, as not only has the species of the protein not been given, neither has the exact identity of the STAT5 molecule. eric.so@kcl.ac.uk Anti-RAR-alpha OR anti-PML antibodies were used to detect the PML-RAR fusion protein. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation TrEMBL Q15156 (PML-RAR fusion protein) has been used as a reference entry only, as the exact sequence of the fusion protein is not known. The exact sequences used in the PLZF-RARa fusion protein are not known either. (Flag)-PHF8 has been identified as "human" (Ref Seq:-NM_015107.2), from Koivisto et al., Clinical Genetics, 2007.On blasting the sequence it corresponds to UniProt ID= Q9UPP1-2. The authors have confirmed that these constructs are of human origin: Flag-PHF8, PML-RARA fusion protein and also His -PML-RARA, GFP- SMRT; also that the cell line "NB4-MR2-PHF8" was transduced with HUMAN PHF8. arteaga-2013-3 The Histone Demethylase PHF8 Governs Retinoic Acid Response in Acute Promyelocytic Leukemia. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Arteaga M.F., Mikesch J.H., Qiu J., Christensen J., Helin K., Kogan S.C., Dong S., So C.W. Cancer - Interactions investigated in the context of cancer Interactions involving Histone H3 have not been included due to lack of antibody specificity. Interactions involving the STAT5-RARa fusion protein have also not been entered, as not only has the species of the protein not been given, neither has the exact identity of the STAT5 molecule. eric.so@kcl.ac.uk Anti-RAR-alpha OR anti-PML antibodies were used to detect the PML-RAR fusion protein. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation TrEMBL Q15156 (PML-RAR fusion protein) has been used as a reference entry only, as the exact sequence of the fusion protein is not known. The exact sequences used in the PLZF-RARa fusion protein are not known either. (Flag)-PHF8 has been identified as "human" (Ref Seq:-NM_015107.2), from Koivisto et al., Clinical Genetics, 2007.On blasting the sequence it corresponds to UniProt ID= Q9UPP1-2. The authors have confirmed that these constructs are of human origin: Flag-PHF8, PML-RARA fusion protein and also His -PML-RARA, GFP- SMRT; also that the cell line "NB4-MR2-PHF8" was transduced with HUMAN PHF8. arteaga-2013-2 The Histone Demethylase PHF8 Governs Retinoic Acid Response in Acute Promyelocytic Leukemia. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arteaga M.F., Mikesch J.H., Qiu J., Christensen J., Helin K., Kogan S.C., Dong S., So C.W. Cancer - Interactions investigated in the context of cancer Interactions involving Histone H3 have not been included due to lack of antibody specificity. Interactions involving the STAT5-RARa fusion protein have also not been entered, as not only has the species of the protein not been given, neither has the exact identity of the STAT5 molecule. eric.so@kcl.ac.uk Anti-RAR-alpha OR anti-PML antibodies were used to detect the PML-RAR fusion protein. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation TrEMBL Q15156 (PML-RAR fusion protein) has been used as a reference entry only, as the exact sequence of the fusion protein is not known. The exact sequences used in the PLZF-RARa fusion protein are not known either. (Flag)-PHF8 has been identified as "human" (Ref Seq:-NM_015107.2), from Koivisto et al., Clinical Genetics, 2007.On blasting the sequence it corresponds to UniProt ID= Q9UPP1-2. The authors have confirmed that these constructs are of human origin: Flag-PHF8, PML-RARA fusion protein and also His -PML-RARA, GFP- SMRT; also that the cell line "NB4-MR2-PHF8" was transduced with HUMAN PHF8. arteaga-2013-1 The Histone Demethylase PHF8 Governs Retinoic Acid Response in Acute Promyelocytic Leukemia. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Arteaga M.F., Mikesch J.H., Qiu J., Christensen J., Helin K., Kogan S.C., Dong S., So C.W. Cancer - Interactions investigated in the context of cancer Interactions involving Histone H3 have not been included due to lack of antibody specificity. Interactions involving the STAT5-RARa fusion protein have also not been entered, as not only has the species of the protein not been given, neither has the exact identity of the STAT5 molecule. eric.so@kcl.ac.uk Anti-RAR-alpha OR anti-PML antibodies were used to detect the PML-RAR fusion protein. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation TrEMBL Q15156 (PML-RAR fusion protein) has been used as a reference entry only, as the exact sequence of the fusion protein is not known. The exact sequences used in the PLZF-RARa fusion protein are not known either. (Flag)-PHF8 has been identified as "human" (Ref Seq:-NM_015107.2), from Koivisto et al., Clinical Genetics, 2007.On blasting the sequence it corresponds to UniProt ID= Q9UPP1-2. The authors have confirmed that these constructs are of human origin: Flag-PHF8, PML-RARA fusion protein and also His -PML-RARA, GFP- SMRT; also that the cell line "NB4-MR2-PHF8" was transduced with HUMAN PHF8. arteaga-2013-4 The Histone Demethylase PHF8 Governs Retinoic Acid Response in Acute Promyelocytic Leukemia. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Arteaga M.F., Mikesch J.H., Qiu J., Christensen J., Helin K., Kogan S.C., Dong S., So C.W. Cancer - Interactions investigated in the context of cancer Interactions involving Histone H3 have not been included due to lack of antibody specificity. Interactions involving the STAT5-RARa fusion protein have also not been entered, as not only has the species of the protein not been given, neither has the exact identity of the STAT5 molecule. eric.so@kcl.ac.uk Anti-RAR-alpha OR anti-PML antibodies were used to detect the PML-RAR fusion protein. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation TrEMBL Q15156 (PML-RAR fusion protein) has been used as a reference entry only, as the exact sequence of the fusion protein is not known. The exact sequences used in the PLZF-RARa fusion protein are not known either. (Flag)-PHF8 has been identified as "human" (Ref Seq:-NM_015107.2), from Koivisto et al., Clinical Genetics, 2007.On blasting the sequence it corresponds to UniProt ID= Q9UPP1-2. The authors have confirmed that these constructs are of human origin: Flag-PHF8, PML-RARA fusion protein and also His -PML-RARA, GFP- SMRT; also that the cell line "NB4-MR2-PHF8" was transduced with HUMAN PHF8. arteaga-2013-6 The Histone Demethylase PHF8 Governs Retinoic Acid Response in Acute Promyelocytic Leukemia. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arteaga M.F., Mikesch J.H., Qiu J., Christensen J., Helin K., Kogan S.C., Dong S., So C.W. Cancer - Interactions investigated in the context of cancer Interactions involving Histone H3 have not been included due to lack of antibody specificity. Interactions involving the STAT5-RARa fusion protein have also not been entered, as not only has the species of the protein not been given, neither has the exact identity of the STAT5 molecule. eric.so@kcl.ac.uk Anti-RAR-alpha OR anti-PML antibodies were used to detect the PML-RAR fusion protein. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation TrEMBL Q15156 (PML-RAR fusion protein) has been used as a reference entry only, as the exact sequence of the fusion protein is not known. The exact sequences used in the PLZF-RARa fusion protein are not known either. (Flag)-PHF8 has been identified as "human" (Ref Seq:-NM_015107.2), from Koivisto et al., Clinical Genetics, 2007.On blasting the sequence it corresponds to UniProt ID= Q9UPP1-2. The authors have confirmed that these constructs are of human origin: Flag-PHF8, PML-RARA fusion protein and also His -PML-RARA, GFP- SMRT; also that the cell line "NB4-MR2-PHF8" was transduced with HUMAN PHF8. q9upp1-2 Histone lysine demethylase PHF8 PHF8 KIAA1111 ZNF422 PHD finger protein 8 [histone H3]-dimethyl-L-lysine(36) demethylase PHF8 [histone H3]-dimethyl-L-lysine(9) demethylase PHF8 protein protein human Homo sapiens Human MASVPVYCLCRLPYDVTRFMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKAERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDGNESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDERLGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAATPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL pram_human _gene PRAM_HUMAN_GENE/PML-RARA-regulated adapter molecule 1 gene gene human Homo sapiens Human id1_human_gene ID1_HUMAN_GENE gene gene human Homo sapiens Human rbl1_human_gene RBL1 protein gene gene gene human Homo sapiens Human tgm2_human_gene TGM2_HUMAN_GENE gene gene human Homo sapiens Human ccne1_human_gene Human Cyclin E1 gene gene gene human Homo sapiens Human rarb_human_gene Human RARBeta gene gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP ncor2_human Nuclear receptor corepressor 2 NCOR2 CTG26 Silencing mediator of retinoic acid and thyroid hormone receptor Thyroid-, retinoic-acid-receptor-associated corepressor T3 receptor-associating factor CTG repeat protein 26 SMAP270 protein protein human Homo sapiens Human MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPPGPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEGEEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGSGRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDRDRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE plzf-rara_fusion_protein PLZF-RARa FUSION PROTEIN protein protein human Homo sapiens Human rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP phf8_human Histone lysine demethylase PHF8 PHF8 KIAA1111 ZNF422 PHD finger protein 8 [histone H3]-dimethyl-L-lysine(36) demethylase PHF8 [histone H3]-dimethyl-L-lysine(9) demethylase PHF8 protein protein human Homo sapiens Human MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKAERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDGNESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDERLGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAATPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL phf8-rarb-2 1383325 n/a 1383331 unspecified role unspecified role bait bait n/a 1383332 unspecified role unspecified role prey prey association association false false false 4A, 5I. ATRA -all-trans retinoic acid The phosphomimetic PHF8DD mutant (ser33asp,ser84asp) as compared with the phosphorylation defective PHF8AA mutant (ser33ala, ser84ala) exhibited a much stronger binding to target promoters of PML-RARa. (No comparison with wild type PHF8 is included.) phf8-tgm2-2 1383325 n/a 1383331 unspecified role unspecified role bait bait n/a 1383333 unspecified role unspecified role prey prey association association false false false 4A, 5I. ATRA -all-trans retinoic acid The phosphomimetic PHF8DD mutant (ser33asp,ser84asp) as compared with the phosphorylation defective PHF8AA mutant (ser33ala, ser84ala) exhibited a much stronger binding to target promoters of PML-RARa. (No comparison with wild type PHF8 is included.) phf8-id1-1 1383325 n/a 1383334 unspecified role unspecified role prey prey n/a 1383331 unspecified role unspecified role bait bait association association false false false 4Biii ATRA - (all-trans retinoic acid)-binding of PHF8 to the promoter regions of RBL1 and CCNE1 was reduced . phf8-tgm2-2 1383325 n/a 1383335 unspecified role unspecified role prey prey n/a 1383331 unspecified role unspecified role bait bait association association false false false 4A, 5I. ATRA -all-trans retinoic acid The phosphomimetic PHF8DD mutant (ser33asp,ser84asp) as compared with the phosphorylation defective PHF8AA mutant (ser33ala, ser84ala) exhibited a much stronger binding to target promoters of PML-RARa. (No comparison with wild type PHF8 is included.) phf8-rbl1-1 1383325 n/a 1383331 unspecified role unspecified role bait bait n/a 1383336 unspecified role unspecified role prey prey association association false false false 4Biv ATRA - (all-trans retinoic acid)-binding of PHF8 to the promoter regions of RBL1 and CCNE1 was reduced . phf8-rarb-2 1383325 n/a 1383337 unspecified role unspecified role prey prey rare_promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383331 unspecified role unspecified role bait bait association association false false false 4A, 5I. ATRA -all-trans retinoic acid The phosphomimetic PHF8DD mutant (ser33asp,ser84asp) as compared with the phosphorylation defective PHF8AA mutant (ser33ala, ser84ala) exhibited a much stronger binding to target promoters of PML-RARa. (No comparison with wild type PHF8 is included.) phf8-rbl1-2 1383325 n/a 1383338 unspecified role unspecified role bait bait lys21 me1lys monomethylated L-lysine Me1Lys Methyl Methylation methylk certain certain sequence position certain certain certain sequence position certain false n/a 1383334 unspecified role unspecified role prey prey association association false false false 4I ATRA - (all-trans retinoic acid) The molecule "H4K20me1" has been entered as "H4K21me1" as there is now no lysine residue at position 20 in the human H4 molecule (UniProt P62805, version 2). The "H4K20" refers to the earlier version (1) of the sequence. hist1h4a-rbl1 1383325 n/a 1383338 unspecified role unspecified role bait bait lys21 me1lys monomethylated L-lysine Me1Lys Methyl Methylation methylk certain certain sequence position certain certain certain sequence position certain false n/a 1383336 unspecified role unspecified role prey prey association association false false false 4J ATRA - (all-trans retinoic acid) The molecule "H4K20me1" has been entered as "H4K21me1" as there is now no lysine residue at position 20 in the human H4 molecule (UniProt P62805, version 2). The "H4K20" refers to the earlier version (1) of the sequence. pml_rar-phf8-1 1383326 n/a 1383339 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383331 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false jmjc_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false physical association physical association false false false 1C pml_rar-phf8-2 1383326 n/a 1383331 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383339 unspecified role unspecified role bait bait physical association physical association false false false Supp 2F pml_rar-ncor2 1383326 n/a 1383331 competitor competitor competitor prey prey Q9UPP1-2:p.[Ser33Asp;Ser84Asp] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383339 unspecified role unspecified role bait bait n/a 1383340 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5J Expression of the phosphomimetic PHF8DD mutant, but not wild-type PHF8 could displace the transcriptional corepressor SMRT from PML-RARα in the absence of ATRA. (species of gfp-SMRT is not stated.) pml_rar-phf8-4 1383326 n/a 1383331 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383341 unspecified role unspecified role bait bait physical association physical association false false false Supp 2Fi pml_rar-ncor2-1 1383326 n/a 1383339 unspecified role unspecified role bait bait n/a 1383340 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5J-2 Expression of the phosphomimetic PHF8DD mutant, but not wild-type PHF8 could displace the transcriptional corepressor SMRT from PML-RARα in the absence of ATRA. (species of gfp-SMRT is not stated.) pml_rar-phf8 1383327 n/a 1383339 unspecified role unspecified role bait bait c_region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false n/a 1383331 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B, 1D, 1E. Region C that partly overlaps with the DNA binding domain in the PML-RARα fusion was absolutely required for the recruitment of PHF8. rara-phf8 1383327 n/a 1383331 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383342 unspecified role unspecified role bait bait physical association physical association false false false 1D and 1E PML-RARα had a much higher ability than wild-type RARα to form complex with PHF8 in the presence of ATRA;the interaction between wild-type RARα and PHF8 rapidly dissociated under stringent washing conditions, while the one between PML-RARα and PHF8 remained stable. phf8-pml_rar-2 1383327 n/a 1383342 unspecified role unspecified role prey prey n/a 1383331 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383339 unspecified role unspecified role prey prey association association false false false 1F PML-RARα had a much higher ability than wild-type RARα to form complex with PHF8 in the presence of ATRA;the interaction between wild-type RARα and PHF8 rapidly dissociated under stringent washing conditions, while the one between PML-RARα and PHF8 remained stable. phf8-pml_rar 1383328 n/a 1383331 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383339 unspecified role unspecified role prey prey physical association physical association false false false 1A ATRA -all-trans retinoic acid phf8-rarb 1383329 n/a 1383337 unspecified role unspecified role prey prey rare_promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1383343 unspecified role unspecified role bait bait association association false false false 1I ATRA -all-trans retinoic acid phf8-pml_rar-3 1383330 n/a 1383343 unspecified role unspecified role bait bait n/a 1383339 unspecified role unspecified role prey prey physical association physical association false false false Supp 1A ATRA -all-trans retinoic acid