IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sharma-2012-1 The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. human-prostate_carcinoma Homo sapiens prostate carcinoma prostate_carcinoma Prostate carcinoma (cancer) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation sharma-2012-3 The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. human-prostate_carcinoma Homo sapiens prostate carcinoma prostate_carcinoma Prostate carcinoma (cancer) ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation sharma-2012-2 The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation sharma-2012-4 The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. human-prostate tissue Homo sapiens prostate prostate ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation sharma-2012-5 The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation fkbp5_human_gene Human FKBP5 gene gene gene human Homo sapiens Human andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ klk3_human_gene Human kallikrein-related peptidase 3 (KLK3) (PSA) gene gene human Homo sapiens Human kkcc2_human_gene KKCC2_HUMAN_GENE gene gene human Homo sapiens Human tmps2_human_gene Human TMPS2/TMPRSS2 gene gene gene human Homo sapiens Human pepc_human_gene PEPC_HUMAN_HUMAN gene gene human Homo sapiens Human ei2be_human_gene EI2BE_HUMAN_GENE gene gene human Homo sapiens Human tyw2_human_gene TYW2_HUMAN_GENE/TRMT12 gene gene human Homo sapiens Human foxa1_human Hepatocyte nuclear factor 3-alpha FOXA1 HNF3A TCF3A Forkhead box protein A1 Transcription factor 3A protein protein human Homo sapiens Human MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS ar-fkbp5-1 1361558 n/a 1361563 unspecified role unspecified role prey prey n/a 1361564 unspecified role unspecified role bait bait association association false false false 1A ar-fkbp5-2 1361558 n/a 1361565 unspecified role unspecified role prey prey n/a 1361564 unspecified role unspecified role bait bait association association false false false 1A ar-klk3-1 1361558 n/a 1361564 unspecified role unspecified role bait bait n/a 1361566 unspecified role unspecified role prey prey association association false false false 1A ar-fkbp5-3 1361558 n/a 1361567 unspecified role unspecified role prey prey n/a 1361564 unspecified role unspecified role bait bait association association false false false 1A ar-klk3-1 1361558 n/a 1361568 unspecified role unspecified role prey prey n/a 1361564 unspecified role unspecified role bait bait association association false false false 1A ar-fkbp5-5 1361559 n/a 1361564 unspecified role unspecified role bait bait n/a 1361567 unspecified role unspecified role prey prey association association false false false 1D ar-fkbp5-5 1361559 n/a 1361564 unspecified role unspecified role bait bait n/a 1361565 unspecified role unspecified role prey prey association association false false false 1B ar-klk3-1 1361559 n/a 1361569 unspecified role unspecified role prey prey n/a 1361564 unspecified role unspecified role bait bait association association false false false 1E ar-tyw2-1 1361559 n/a 1361564 unspecified role unspecified role bait bait n/a 1361570 unspecified role unspecified role prey prey association association false false false 8A ar-fkbp5-4 1361560 n/a 1361564 unspecified role unspecified role bait bait n/a 1361567 unspecified role unspecified role prey prey association association false false false 1D ar-fkbp5-4 1361560 n/a 1361564 unspecified role unspecified role bait bait n/a 1361565 unspecified role unspecified role prey prey association association false false false 1B ar-fkbp5-6 1361561 n/a 1361565 unspecified role unspecified role prey prey n/a 1361564 unspecified role unspecified role bait bait association association false false false 1B ar-foxa1-1 1361562 n/a 1361571 unspecified role unspecified role prey prey n/a 1361564 unspecified role unspecified role bait bait physical association physical association false false false 6D An attenuated AR-FOXA1 interaction was seen in in xenografts, in comparison with cultured cells, and also a gain of AR-STAT5 interaction in xenografts.