IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ abdel_wahab-2012-4 ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. human-set2 SET2 - Human acute leukemia cell line (megakaryoblastic) set2 SET2 Human acute leukemia cell line (megakaryoblastic) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation abdel_wahab-2012-8 ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. human-nomo-1 human nomo-1 nomo-1 NOMO-1 Human AML cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer The interaction with the HOXA8 gene cannot be entered as this gene does not exist (in vertebrates) - see UniProt hoxlist.txt Release 2012_09. chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation abdel_wahab-2012-1 ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. human-uke1 HUMAN UKE1 - (secondary acute) myeloid leukemic cell line uke1 UKE1 Human (secondary acute) myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer Human AML cells from from four different cell lines, two of these express ASXL1 (UKE1 and SET2), and two either do not express ASXL1 - or express it at a much reduced level (NOMO1 and K562). chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation abdel_wahab-2012-6 ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. human-nomo-1 human nomo-1 nomo-1 NOMO-1 Human AML cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation abdel_wahab-2012-7 ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation abdel_wahab-2012-2 ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. human-set2 SET2 - Human acute leukemia cell line (megakaryoblastic) set2 SET2 Human acute leukemia cell line (megakaryoblastic) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation abdel_wahab-2012-3 ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation bap1_human Ubiquitin carboxyl-terminal hydrolase BAP1 BAP1 KIAA0272 hucep-6 BRCA1-associated protein 1 Cerebral protein 6 protein protein human Homo sapiens Human MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKGKGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ asxl1_human Polycomb group protein ASXL1 ASXL1 KIAA0978 Additional sex combs-like protein 1 protein protein human Homo sapiens Human MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKKDALQWSRHPATVEGEEPEDTADVESCGSNEASTVSGENDVSLDETSSNASCSTESQSRPLSNPRDSYRASSQANKQKKKTGVMLPRVVLTPLKVNGAHVESASGFSGCHADGESGSPSSSSSGSLALGSAAIRGQAEVTQDPAPLLRGFRKPATGQMKRNRGEEIDFETPGSILVNTNLRALINSRTFHALPSHFQQQLLFLLPEVDRQVGTDGLLRLSSSALNNEFFTHAAQSWRERLADGEFTHEMQVRIRQEMEKEKKVEQWKEKFFEDYYGQKLGLTKEESLQQNVGQEEAEIKSGLCVPGESVRIQRGPATRQRDGHFKKRSRPDLRTRARRNLYKKQESEQAGVAKDAKSVASDVPLYKDGEAKTDPAGLSSPHLPGTSSAAPDLEGPEFPVESVASRIQAEPDNLARASASPDRIPSLPQETVDQEPKDQKRKSFEQAASASFPEKKPRLEDRQSFRNTIESVHTEKPQPTKEEPKVPPIRIQLSRIKPPWVVKGQPTYQICPRIIPTTESSCRGWTGARTLADIKARALQVRGARGHHCHREAATTAIGGGGGPGGGGGGATDEGGGRGSSSGDGGEACGHPEPRGGPSTPGKCTSDLQRTQLLPPYPLNGEHTQAGTAMSRARREDLPSLRKEESCLLQRATVGLTDGLGDASQLPVAPTGDQPCQALPLLSSQTSVAERLVEQPQLHPDVRTECESGTTSWESDDEEQGPTVPADNGPIPSLVGDDTLEKGTGQALDSHPTMKDPVNVTPSSTPESSPTDCLQNRAFDDELGLGGSCPPMRESDTRQENLKTKALVSNSSLHWIPIPSNDEVVKQPKPESREHIPSVEPQVGEEWEKAAPTPPALPGDLTAEEGLDPLDSLTSLWTVPSRGGSDSNGSYCQQVDIEKLKINGDSEALSPHGESTDTASDFEGHLTEDSSEADTREAAVTKGSSVDKDEKPNWNQSAPLSKVNGDMRLVTRTDGMVAPQSWVSRVCAVRQKIPDSLLLASTEYQPRAVCLSMPGSSVEATNPLVMQLLQGSLPLEKVLPPAHDDSMSESPQVPLTKDQSHGSLRMGSLHGLGKNSGMVDGSSPSSLRALKEPLLPDSCETGTGLARIEATQAPGAPQKNCKAVPSFDSLHPVTNPITSSRKLEEMDSKEQFSSFSCEDQKEVRAMSQDSNSNAAPGKSPGDLTTSRTPRFSSPNVISFGPEQTGRALGDQSNVTGQGKKLFGSGNVAATLQRPRPADPMPLPAEIPPVFPSGKLGPSTNSMSGGVQTPREDWAPKPHAFVGSVKNEKTFVGGPLKANAENRKATGHSPLELVGHLEGMPFVMDLPFWKLPREPGKGLSEPLEPSSLPSQLSIKQAFYGKLSKLQLSSTSFNYSSSSPTFPKGLAGSVVQLSHKANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR ring1_human E3 ubiquitin-protein ligase RING1 RING finger protein 1 Polycomb complex protein RING1 RING1 RNF1 Really interesting new gene 1 protein RING-type E3 ubiquitin transferase RING1 protein protein human Homo sapiens Human MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK bmi1_human Polycomb complex protein BMI-1 BMI1 PCGF4 RNF51 Polycomb group RING finger protein 4 RING finger protein 51 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG hxa11_human_gene HOXA11 Human Gene gene gene human Homo sapiens Human hxa10_human_gene HOXA10 Human Gene gene gene human Homo sapiens Human hxa9_human_gene HumanHomeobox protein Hox-A9 gene gene gene human Homo sapiens Human hxa5_human_gene HOXA5 Human Gene gene gene human Homo sapiens Human hxa6_human_gene HOXA6 Human Gene gene gene human Homo sapiens Human hxa7_human_gene HOXA7 Human Gene gene gene human Homo sapiens Human suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL bap1-asxl1-2 1314649 n/a 1314656 unspecified role unspecified role bait bait n/a 1314657 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A An association was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) and but not in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). asxl1-ezh2-2 1314649 n/a 1314658 unspecified role unspecified role prey prey n/a 1314657 unspecified role unspecified role bait bait physical association physical association false false false Fig 6B ezh2-asxl1 1314649 n/a 1314657 unspecified role unspecified role prey prey n/a 1314658 unspecified role unspecified role bait bait physical association physical association false false false Fig 6B ezh2-asxl1-2 1314649 n/a 1314658 unspecified role unspecified role bait bait n/a 1314657 unspecified role unspecified role prey prey n/a 1314659 unspecified role unspecified role prey prey association association false false false Fig 6C An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). eed-asxl1-1 1314649 n/a 1314659 unspecified role unspecified role bait bait n/a 1314657 unspecified role unspecified role prey prey physical association physical association false false false Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. bmi1-ring1-4 1314649 n/a 1314660 unspecified role unspecified role prey prey n/a 1314661 unspecified role unspecified role bait bait physical association physical association false false false Fig 6C ezh2-hxa11-1 1314650 n/a 1314657 unspecified role unspecified role bait bait n/a 1314662 unspecified role unspecified role prey prey association association false false false 4E ezh2-hxa10-1 1314650 n/a 1314657 unspecified role unspecified role bait bait n/a 1314663 unspecified role unspecified role prey prey association association false false false 4E asxl1-hxa9 1314650 n/a 1314657 unspecified role unspecified role bait bait n/a 1314664 unspecified role unspecified role prey prey association association false false false 4E asxl1-hxa9-1 1314650 n/a 1314665 unspecified role unspecified role prey prey n/a 1314657 unspecified role unspecified role bait bait association association false false false 4E asxl1-hxa5 1314650 n/a 1314666 unspecified role unspecified role prey prey n/a 1314657 unspecified role unspecified role bait bait association association false false false 4E asxl1-hxa6 1314650 n/a 1314657 unspecified role unspecified role bait bait n/a 1314667 unspecified role unspecified role prey prey association association false false false 4E bap1-asxl1-1 1314651 n/a 1314656 unspecified role unspecified role bait bait n/a 1314657 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A An association was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) and but not in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). ezh2-asxl1-1 1314651 n/a 1314659 unspecified role unspecified role prey prey n/a 1314657 unspecified role unspecified role prey prey n/a 1314658 unspecified role unspecified role bait bait association association false false false Fig 6C, S5. An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). eed-asxl1 1314651 n/a 1314657 unspecified role unspecified role prey prey n/a 1314659 unspecified role unspecified role bait bait physical association physical association false false false Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. asxl1-eed-1 1314651 n/a 1314657 unspecified role unspecified role bait bait n/a 1314658 unspecified role unspecified role prey prey n/a 1314659 unspecified role unspecified role prey prey association association false false false Fig S5. IP of ASXL1 did not reveal pulldown of BMI1 in UKE1 cells. bmi1-ring1-3 1314651 n/a 1314660 unspecified role unspecified role prey prey n/a 1314661 unspecified role unspecified role bait bait physical association physical association false false false Fig 6C asxl1-ezh2-5 1314652 n/a 1314658 unspecified role unspecified role bait bait n/a 1314659 unspecified role unspecified role prey prey physical association physical association false false false Fig 6C An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). eed-asxl1-2 1314652 n/a 1314659 unspecified role unspecified role bait bait n/a 1314657 unspecified role unspecified role prey prey physical association physical association false false false Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. bmi1-ring1-5 1314652 n/a 1314661 unspecified role unspecified role bait bait n/a 1314660 unspecified role unspecified role prey prey physical association physical association false false false Fig 6C eed-asxl1-3 1314653 n/a 1314657 unspecified role unspecified role prey prey n/a 1314659 unspecified role unspecified role bait bait physical association physical association false false false Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. asxl1-ezh2-6 1314653 n/a 1314658 unspecified role unspecified role bait bait n/a 1314659 unspecified role unspecified role prey prey physical association physical association false false false Fig 6C An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). bmi1-ring1-6 1314653 n/a 1314660 unspecified role unspecified role prey prey n/a 1314661 unspecified role unspecified role bait bait physical association physical association false false false Fig 6C ezh2-hxa10 1314654 n/a 1314663 unspecified role unspecified role prey prey n/a 1314658 unspecified role unspecified role bait bait association association false false false Fig 5E ASXL1 deletion results in loss of binding of EZH2. ezh2-hxa11 1314654 n/a 1314658 unspecified role unspecified role bait bait n/a 1314662 unspecified role unspecified role prey prey association association false false false Fig 5E ASXL1 deletion results in loss of binding of EZH2. asxl1-ezh2-1 1314655 n/a 1314658 unspecified role unspecified role prey prey n/a 1314657 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1314668 unspecified role unspecified role prey prey association association false false false Fig 6A asxl1-bap1 1314655 n/a 1314656 unspecified role unspecified role prey prey n/a 1314657 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false association association false false false Fig S2A Nonsense mutation in ASXL1 results in partial (629X) or complete (936X) loss of binding.