IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ oricchio-2011-3 The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Cell (0092-8674) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer oricchio-2011-1 The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Cell (0092-8674) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer oricchio-2011-2 The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Cell (0092-8674) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer oricchio-2011-4 The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Cell (0092-8674) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer epha7_human Ephrin type-A receptor 7 EPHA7 EHK3 HEK11 EPH-like kinase 11 EPH homology kinase 3 protein protein human Homo sapiens Human MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV epha2_human Ephrin type-A receptor 2 Tyrosine-protein kinase receptor ECK Epithelial cell kinase EPHA2 ECK protein protein human Homo sapiens Human MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPI epha3_human Ephrin type-A receptor 3 EPHA3 ETK ETK1 TYRO4 Tyrosine-protein kinase receptor ETK1 HEK Tyrosine-protein kinase TYRO4 EPH-like kinase 4 protein protein human Homo sapiens Human MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGPVPV efna1_mouse Ephrin-A1 Efna1 Epgl1 Epl1 Lerk1 EPH-related receptor tyrosine kinase ligand 1 Immediate early response protein B61 protein protein mouse Mus musculus Mouse MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLLQSQ efna4_human Ephrin-A4 EFNA4 EPLG4 LERK4 EPH-related receptor tyrosine kinase ligand 4 protein protein human Homo sapiens Human MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL efna5_human Ephrin-A5 EFNA5 EPLG7 LERK7 EPH-related receptor tyrosine kinase ligand 7 AL-1 protein protein human Homo sapiens Human MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL epha2-epha7 1233787 n/a 1233791 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. n/a 1233792 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 1233803 1233800 direct interaction direct interaction false false false Supp. Fig. 5N epha3-epha7 1233787 n/a 1233791 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. n/a 1233793 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 1233810 1233808 direct interaction direct interaction false false false Supp. Fig. 5N efna1-epha7 1233787 n/a 1233791 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. n/a 1233794 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 1233819 1233815 direct interaction direct interaction false false false Supp. Fig. 5P efna4-epha7 1233787 n/a 1233795 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. n/a 1233791 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 1233826 1233822 direct interaction direct interaction false false false Supp. Fig. 5P efna5-epha7 1233787 n/a 1233796 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. n/a 1233791 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. direct interaction direct interaction false false false Supp. Fig. 5P epha7-epha2 1233788 n/a 1233791 unspecified role unspecified role bait bait c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. n/a 1233792 unspecified role unspecified role prey prey human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells physical association physical association false false false Fig. 5B epha7-epha2-1 1233789 n/a 1233792 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-dohh2 Human DOHH2 lymphoma follicular B cell dohh2 DoHH2 lymphoma, follicular, B cells n/a 1233791 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 1233846 1233844 physical association physical association false false false Supp. Fig. 5C efna1-epha7-2 1233790 n/a 1233794 unspecified role unspecified role bait bait c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1233791 unspecified role unspecified role prey prey c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false Q15375:p.Thr105Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Supp. Fig. 5S Normal B-lymphocytes express only a truncated EPHA7 protein that lacks the intracellular domains - exact coordinates of truncation not given.