IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ni-2011-2 Targeting androgen receptor in estrogen receptor-negative breast cancer. human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation ni-2011-6 Targeting androgen receptor in estrogen receptor-negative breast cancer. human-sum185pe Human SUM185PE sum185pe Human SUM185PE breast carcinoma cell line LAR (luminal androgen receptor) subtype, triple negative (ER-,PR-,HER2-) , PIK3CA activating mutation - H1047R. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation ni-2011-1 Targeting androgen receptor in estrogen receptor-negative breast cancer. human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation ni-2011-4 Targeting androgen receptor in estrogen receptor-negative breast cancer. human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation ni-2011-3 Targeting androgen receptor in estrogen receptor-negative breast cancer. human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation ni-2011-5 Targeting androgen receptor in estrogen receptor-negative breast cancer. human-hcc202 HUMAN HCC202 hcc202 Human HC202 ductal carcinoma cell line, ER-,PR-, p53-, HER2+. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-2316&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ dep1a_human_gene DEP domain-containing protein 1A gene gene gene human Homo sapiens Human foxa1_human Hepatocyte nuclear factor 3-alpha FOXA1 HNF3A TCF3A Forkhead box protein A1 Transcription factor 3A protein protein human Homo sapiens Human MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS erbb3_human_gene Human ERBB3 gene gene human Homo sapiens Human ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL tf7l2_human Transcription factor 7-like 2 TCF7L2 TCF4 HMG box transcription factor 4 T-cell-specific transcription factor 4 protein protein human Homo sapiens Human MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE ar-wnt7b-1 1168504 n/a 1168510 unspecified role unspecified role bait bait n/a 1168511 unspecified role unspecified role prey prey association association false false false 4B DHT (5alpha-dihydrotestosterone) An AR binding site was found within the WNT7B gene locus (+1.5 kb of TSS). The occupancy of AR at this site was enriched only after DHT stimulation. foxa1-erbb3-1 1168504 n/a 1168512 unspecified role unspecified role bait bait n/a 1168513 unspecified role unspecified role prey prey association association false false false 6B FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT ctnnb1-erbb3 1168504 n/a 1168513 unspecified role unspecified role prey prey n/a 1168514 unspecified role unspecified role bait bait association association false false false 6B, S5H FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT Inhibitors targeting AR and Wnt/beta-catenin pathways [AR (bicalutamide), Wnt/beta-catenin (IWP2 and IWR1)] were able to reduce the DHT-induced recruitment of AR and beta-catenin to the HER3 gene. ar-erbb3-1 1168504 n/a 1168510 unspecified role unspecified role bait bait n/a 1168513 unspecified role unspecified role prey prey association association false false false 6B, S5H FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT Inhibitors targeting AR and Wnt/beta-catenin pathways [AR (bicalutamide), Wnt/β-catenin (IWP2 and IWR1)] were able to reduce the DHT-induced recruitment of AR and beta-catenin to the HER3 gene. tcf7l2-erbb3 1168504 n/a 1168515 unspecified role unspecified role bait bait n/a 1168513 unspecified role unspecified role prey prey association association false false false S5D TCF4 was able to occupy the same genomic region (as AR/FOXA1) in the absence of DHT, however recruitment of TCF4 to HER3 gradually declined after DHT stimulation. DHT ar-wnt7b-3 1168505 n/a 1168511 unspecified role unspecified role prey prey n/a 1168510 unspecified role unspecified role bait bait association association false false false S4H DHT (5alpha-dihydrotestosterone) foxa1-erbb3-2 1168505 n/a 1168512 unspecified role unspecified role bait bait n/a 1168513 unspecified role unspecified role prey prey association association false false false S5E FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT ar-erbb3-2 1168505 n/a 1168513 unspecified role unspecified role prey prey n/a 1168510 unspecified role unspecified role bait bait association association false false false S5E FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT ctnnb1-erbb3-1 1168505 n/a 1168514 unspecified role unspecified role bait bait n/a 1168513 unspecified role unspecified role prey prey association association false false false S5E FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT ar-wnt7b 1168506 n/a 1168511 unspecified role unspecified role prey prey n/a 1168510 unspecified role unspecified role bait bait association association false false false 4A An AR binding site within the WNT7B gene locus (+1.5 kb of TSS) was identified (Figure 4A). ar-erbb3 1168506 n/a 1168510 unspecified role unspecified role bait bait n/a 1168513 unspecified role unspecified role prey prey association association false false false 6A An overlapping AR and FOXA1 binding site was found within the HER3 gene locus, close to the TSS. foxa1-erbb3 1168506 n/a 1168512 unspecified role unspecified role bait bait n/a 1168513 unspecified role unspecified role prey prey association association false false false 6A An overlapping AR and FOXA1 binding site was found within the HER3 gene locus, close to the TSS. ar-ctnnb1-3 1168507 n/a 1168510 unspecified role unspecified role bait bait n/a 1168514 unspecified role unspecified role prey prey association association false false false 5A DHT (5alpha-dihydrotestosterone) ctnnb1-ar-1 1168507 n/a 1168510 unspecified role unspecified role prey prey n/a 1168514 unspecified role unspecified role bait bait association association false false false 5A DHT (5alpha-dihydrotestosterone) ar-ctnnb1-1 1168508 n/a 1168514 unspecified role unspecified role neutral component neutral component n/a 1168510 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4E DHT (5alpha-dihydrotestosterone) DHT treatment induced the nuclear accumulation of both beta-catenin and AR. ar-wnt7b-2 1168509 n/a 1168510 unspecified role unspecified role bait bait n/a 1168511 unspecified role unspecified role prey prey association association false false false S4G DHT (5alpha-dihydrotestosterone)