I2D I2D girnita-2012-2 Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Ada.Girnita@ki.se Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database girnita-2012-3 Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Mouse embryonic fibroblasts with a targeted disruption of the mouse IGF-1R protein were used to over-express human IGF-1R. Ada.Girnita@ki.se Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database girnita-2012-1 Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Ada.Girnita@ki.se Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database igf1r_human Insulin-like growth factor 1 receptor Insulin-like growth factor I receptor IGF1R protein protein human Homo sapiens Human MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC p49913-pro_0000004724 Antibacterial peptide LL-37 CAMP CAP18 FALL39 18 kDa cationic antimicrobial protein HSD26 protein protein human Homo sapiens Human [LL-37, 37 aa] 134 170 arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR arrb1_mouse Beta-arrestin-1 Arrestin beta-1 Arrb1 protein protein mouse Mus musculus Mouse MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDNVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR igf1r-camp-1 1322523 n/a 1322526 unspecified role unspecified role bait bait n/a 1322527 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 2a, b,c arrb1-igf1r 1322523 n/a 1322526 unspecified role unspecified role prey prey n/a 1322528 unspecified role unspecified role bait bait physical association physical association false false false 5b igf1r-camp-2 1322524 n/a 1322526 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1322527 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 2c,4b arrb1-igf1r-1 1322524 n/a 1322529 unspecified role unspecified role bait bait n/a 1322526 unspecified role unspecified role prey prey physical association physical association false false false 5b igf1r-camp 1322525 n/a 1322527 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1322526 unspecified role unspecified role bait bait human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association false false false 1