I2D I2D morinaka-2011-3 Oligomeric peroxiredoxin-I is an essential intermediate for p53 to activate MST1 kinase and apoptosis. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Morinaka A., Funato Y., Uesugi K., Miki H. Apoptosis - Interactions involving proteins with a function related to apoptosis PRX-1 Cys to Ser mutant is at position 52 of P35700, not 51 as stated in paper. hmiki@protein.osaka-u.ac.jp Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer morinaka-2011-4 Oligomeric peroxiredoxin-I is an essential intermediate for p53 to activate MST1 kinase and apoptosis. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Morinaka A., Funato Y., Uesugi K., Miki H. Apoptosis - Interactions involving proteins with a function related to apoptosis PRX-1 Cys to Ser mutant is at position 52 of P35700, not 51 as stated in paper. hmiki@protein.osaka-u.ac.jp Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer morinaka-2011-1 Oligomeric peroxiredoxin-I is an essential intermediate for p53 to activate MST1 kinase and apoptosis. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Morinaka A., Funato Y., Uesugi K., Miki H. Apoptosis - Interactions involving proteins with a function related to apoptosis PRX-1 Cys to Ser mutant is at position 52 of P35700, not 51 as stated in paper. hmiki@protein.osaka-u.ac.jp Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer morinaka-2011-2 Oligomeric peroxiredoxin-I is an essential intermediate for p53 to activate MST1 kinase and apoptosis. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Morinaka A., Funato Y., Uesugi K., Miki H. Apoptosis - Interactions involving proteins with a function related to apoptosis PRX-1 Cys to Ser mutant is at position 52 of P35700, not 51 as stated in paper. hmiki@protein.osaka-u.ac.jp Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer morinaka-2011-5 Oligomeric peroxiredoxin-I is an essential intermediate for p53 to activate MST1 kinase and apoptosis. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Morinaka A., Funato Y., Uesugi K., Miki H. Apoptosis - Interactions involving proteins with a function related to apoptosis PRX-1 Cys to Ser mutant is at position 52 of P35700, not 51 as stated in paper. hmiki@protein.osaka-u.ac.jp Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer morinaka-2011-6 Oligomeric peroxiredoxin-I is an essential intermediate for p53 to activate MST1 kinase and apoptosis. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Morinaka A., Funato Y., Uesugi K., Miki H. Apoptosis - Interactions involving proteins with a function related to apoptosis PRX-1 Cys to Ser mutant is at position 52 of P35700, not 51 as stated in paper. Native SDS–PAGE and Coomassie Brilliant Blue (CBB) staining. hmiki@protein.osaka-u.ac.jp Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer stk4_human Serine/threonine-protein kinase 4 STK4 MST1 STE20-like kinase MST1 Mammalian STE20-like protein kinase 1 Serine/threonine-protein kinase Krs-2 KRS2 protein protein human Homo sapiens Human METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF prdx1_mouse Peroxiredoxin-1 Thioredoxin-dependent peroxiredoxin 1 Thioredoxin-dependent peroxide reductase 2 Osteoblast-specific factor 3 Macrophage 23 kDa stress protein Thioredoxin peroxidase 2 Prdx1 Msp23 Paga Tdpx2 protein protein mouse Mus musculus Mouse MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK mob1a_human MOB kinase activator 1A MOB1A C2orf6 MOB4B MOBK1B MOBKL1B Mob1 alpha Mob1 homolog 1B Mps one binder kinase activator-like 1B protein protein human Homo sapiens Human MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR mob1a-prdx1 1214895 n/a 1214901 enzyme enzyme neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1214902 unspecified role unspecified role ancillary ancillary P35700:p.Cys83Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35700:p.Cys173Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false P35700:p.Cys52Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 n/a 1214903 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 2b Hydrogen peroxide treatment increases phosphorylation of MOBKL1B. Mutations C52S and C83S reduced phosphorylation of MOBKL1B. The mutation C173S increased phosphorylation of MOBKL1B and autophosphorylation of MST1. mob1a-prdx1-1 1214895 n/a 1214901 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1214903 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1214902 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false S8 Hydrogen peroxide treatment increases phosphorylation of MOBKL1B. stk4-1 1214895 n/a 1214901 putative self putative self putative self putative self region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false true false 2b MST-1 undergoes autophosphorylation. hydrogen peroxide prdx1-stk4-3 1214896 n/a 1214901 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1214902 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 5b Hydrogen peroxide treatment increases phosphorylation of MST1. stk4-1 1214896 n/a 1214901 putative self putative self putative self putative self region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false true false 5b MST-1 undergoes autophosphorylation. prdx1-stk4 1214897 n/a 1214902 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35700:p.Cys52Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P35700:p.Cys83Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P35700:p.Cys173Ser mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false n/a 1214901 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1b, c, 4a Treatment with 100uM hydrogen peroxide for 30 minutes increases the association of PRX1 with MST1. Treatment with cisplatin for 12 or 24 hours increases the association of PRX1 with MST1. stk4-prdx1 1214898 n/a 1214902 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1214901 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction false false false 1e, 5c Treatment with 10 or 100uM hydrogen peroxide for 30 minutes increases the association of PRX1 with MST1. prdx1-prdx1-2 1214899 n/a 1214902 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1214902 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1a prdx1-prdx1-1 1214900 n/a 1214902 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1214902 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1e