UniProt UniProt http://www.uniprot.org sircoulomb-2011-1 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr EMBO Mol Med (1757-4676) 2011 mimix curation sircoulomb-2011-2 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. human-hcc-1500 Homo sapiens Breast Carcinoma cell line hcc-1500 HCC-1500 Human Breast Carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr EMBO Mol Med (1757-4676) 2011 mimix curation sircoulomb-2011-3 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. human-mda_mb_134 Homo sapiens epithelial breast cancer cell line MDA-MB-134 mda_134 Human breast carcinoma cell line MDA-MB-134 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr EMBO Mol Med (1757-4676) 2011 mimix curation sircoulomb-2011-4 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr EMBO Mol Med (1757-4676) 2011 mimix curation sircoulomb-2011-5 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr EMBO Mol Med (1757-4676) 2011 mimix curation zn703_human Zinc finger protein 703 ZNF703 ZEPPO1 ZPO1 Zinc finger elbow-related proline domain protein 1 protein protein human Homo sapiens Human MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHTGHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGLGAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGGELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ dcaf7_human DDB1- and CUL4-associated factor 7 DCAF7 HAN11 WD repeat-containing protein An11 homolog WDR68 WD repeat-containing protein 68 protein protein human Homo sapiens Human MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV ch60_human 60 kDa heat shock protein, mitochondrial HSPD1 HSP60 Heat shock protein 60 60 kDa chaperonin Chaperonin 60 Mitochondrial matrix protein P1 P60 lymphocyte protein HuCHA60 protein protein human Homo sapiens Human MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF phb2_human Prohibitin-2 BAP REA PHB2 D-prohibitin B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity protein protein human Homo sapiens Human MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK znf703-dcaf7 1467725 n/a 1467730 unspecified role unspecified role bait bait n/a 1467731 unspecified role unspecified role prey prey n/a 1467732 unspecified role unspecified role prey prey n/a 1467733 unspecified role unspecified role prey prey association association false false false 2C left, Supp table 7. znf703-dcaf7-6 1467726 n/a 1467731 unspecified role unspecified role prey prey n/a 1467732 unspecified role unspecified role prey prey n/a 1467730 unspecified role unspecified role bait bait association association false false false 2C right znf703-dcaf7-7 1467727 n/a 1467732 unspecified role unspecified role prey prey n/a 1467730 unspecified role unspecified role bait bait n/a 1467731 unspecified role unspecified role prey prey association association false false false 2C right znf703-dcaf7-8 1467728 n/a 1467730 unspecified role unspecified role bait bait n/a 1467731 unspecified role unspecified role prey prey n/a 1467732 unspecified role unspecified role prey prey association association false false false Supplementary figure 6 dcaf7-znf703 1467729 n/a 1467730 unspecified role unspecified role neutral component neutral component n/a 1467731 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2D