I2D I2D yang-2011-1 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database yang-2011-3 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database yang-2011-2 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database yang-2011-4 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database yang-2011-5 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database yang-2011-6 Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ hdac4_human Histone deacetylase 4 HDAC4 KIAA0288 protein protein human Homo sapiens Human MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV ar-hdac4 1145706 n/a 1145712 unspecified role unspecified role prey prey n/a 1145713 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3a Binding of HDAC4 to AR is increased in the presence of 10nm methyltrienolone (R1881). hdac4-ar 1145706 n/a 1145713 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145712 unspecified role unspecified role prey prey physical association physical association false false false 3a Binding of HDAC4 to AR is increased in the presence of 10nm methyltrienolone (R1881). ar-sumo1 1145706 n/a 1145714 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145712 unspecified role unspecified role bait bait P10275:p.[Lys388Arg;Lys521Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5b AR sumoylation is enhanced by co-transfection of Flag-HDAC4. Cells were treated with 10nM R1881 for 24hr Author confirms that Flag-AR and HA-SUMO1 were both of human origin. hdac4-ar-2 1145707 n/a 1145712 unspecified role unspecified role prey prey n/a 1145713 unspecified role unspecified role bait bait physical association physical association false false false 3c Binding of HDAC4 to AR increased in the presence of 10nm methyltrienolone (R1881). sumo1-ar-5 1145707 n/a 1145712 unspecified role unspecified role prey prey n/a 1145714 unspecified role unspecified role bait bait physical association physical association false false false 7a, b, f Cells were treated with 10nM R1881 AR sumoylation is enhanced by co-transfection of Flag-HDAC4 in a dose-dependent manner. ar-sumo1-1 1145707 n/a 1145712 unspecified role unspecified role bait bait n/a 1145714 unspecified role unspecified role prey prey physical association physical association false false false 7a Cells were treated with 10nM R1881 hdac4-ar-1 1145708 n/a 1145712 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated in vitro In vitro n/a 1145713 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 3b In vitro direct binding of HDAC4 to AR is independent of R1881. sumo1-ar-2 1145708 n/a 1145712 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145714 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5c Co-transfection of Flag-HDAC4 increases the sumoylation of AR. Sumoylation of AR increases with the addition of 10ng R1881 Author confirms that Flag-AR and His-SUMO1 are both of human origin. sumo1-ar-1 1145709 n/a 1145712 unspecified role unspecified role prey prey n/a 1145714 unspecified role unspecified role bait bait physical association physical association false false false 5a Cells were treated with 10nM R1881 for 24 hrs. increasing amounts of Flag-HDAC4 enhance ectopic AR conjugation with endogenous SUMO1. sumo1-ar-3 1145710 n/a 1145714 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) n/a 1145712 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated P10275:p.[Lys388Arg;Lys521Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro sumoylation sumoylation reaction sumoylation false false false 5d Sumoylation of AR increases in the presence of HDAC4 sumo1-ar-4 1145711 n/a 1145712 unspecified role unspecified role prey prey n/a 1145714 unspecified role unspecified role bait bait physical association physical association false false false 6a AR sumoylation is enhanced by co-transfection of increasing amounts of Flag-HDAC4. Cells were treated with 10nM R1881