IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hu-2011a-1 BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer sjfan@suda.edu.cn Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation hu-2011a-2 BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer sjfan@suda.edu.cn Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation hu-2011a-3 BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer sjfan@suda.edu.cn Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation btg2_human Protein BTG2 BTG family member 2 NGF-inducible anti-proliferative protein PC3 BTG2 PC3 protein protein human Homo sapiens Human MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ btg2-ar 1308505 n/a 1308508 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P78543:p.[Leu92Ala;Leu96Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1308509 unspecified role unspecified role prey prey human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma physical association physical association false false false Fig 1B DHT btg2-ar-1 1308505 n/a 1308508 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1308509 unspecified role unspecified role prey prey human-cwr22 CWR22- Human Prostatic carcinoma xenografted cell line cwr22 CWR22 Human Prostatic Carcinoma xenografted cell line physical association physical association false false false Fig 1B-2 DHT ar-btg2 1308506 n/a 1308509 unspecified role unspecified role bait bait n/a 1308508 unspecified role unspecified role prey prey physical association physical association false false false Fig 1C DHT btg2-ar-3 1308507 n/a 1308508 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P78543:p.[Leu92Ala;Leu96Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1308509 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig 1D DHT