I2D I2D ythier-2010-3 Sumoylation of ING2 regulates the transcription mediated by Sin3A. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer remy.pedeux@univ-rennes1.fr Oncogene (0950-9232) 2010 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database ythier-2010-1 Sumoylation of ING2 regulates the transcription mediated by Sin3A. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer remy.pedeux@univ-rennes1.fr Oncogene (0950-9232) 2010 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database ythier-2010-2 Sumoylation of ING2 regulates the transcription mediated by Sin3A. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference pull down pull down western blot western blot Immuno blot Immuno blot Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer Author confirms that HIS-SUMO1 construct if of human origin. remy.pedeux@univ-rennes1.fr Oncogene (0950-9232) 2010 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database ing2_human Inhibitor of growth protein 2 ING2 p33ING2 Inhibitor of growth 1-like protein p32 ING1L protein protein human Homo sapiens Human MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR ostp_human_gene Human osteopontin gene gene human Homo sapiens Human tmm71_human_gene Human Transmembrane Protein 71 gene gene human Homo sapiens Human sin3a_human Paired amphipathic helix protein Sin3a SIN3A Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein human Homo sapiens Human MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV ostp-ing2 1007712 n/a 1007715 unspecified role unspecified role bait bait n/a 1007716 unspecified role unspecified role prey prey association association false false false Fig. 5d tmm71-ing2-1 1007712 n/a 1007715 unspecified role unspecified role bait bait Q9H160:p.Glu197Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1007717 unspecified role unspecified role prey prey association association false false false Fig. 5d, 6c tmm71-sin3a 1007712 n/a 1007718 unspecified role unspecified role bait bait n/a 1007717 unspecified role unspecified role prey prey association association false false false Fig. 6c Interaction not observed in the absence of ING2. tmm71-sin3a 1007712 n/a 1007718 unspecified role unspecified role bait bait n/a 1007717 unspecified role unspecified role prey prey association association false false false Fig. 6c ing2-sin3a 1007713 n/a 1007718 unspecified role unspecified role bait bait n/a 1007715 unspecified role unspecified role prey prey Q9H160:p.Lys195Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9H160:p.Glu197Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1a, 4a, 4c ing2-sumo1 1007714 n/a 1007715 unspecified role unspecified role prey prey Q9H160:p.Glu197Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q9H160:p.Lys195Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1007719 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1c, 2c, 2d