I2D I2D oram-2010-1 A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Oram SH., Thoms JA., Pridans C., Janes ME., Kinston SJ., Anand S., Landry JR., Lock RB., Jayaraman PS., Huntly BJ., Pimanda JE., Gottgens B. Cancer - Interactions investigated in the context of cancer Author confirms that ERG and LMO2 constructs are of human origin whereas the FLI1 construct is murine. bg200@cam.ac.uk Oncogene (0950-9232) 2010 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database oram-2010-2 A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Oram SH., Thoms JA., Pridans C., Janes ME., Kinston SJ., Anand S., Landry JR., Lock RB., Jayaraman PS., Huntly BJ., Pimanda JE., Gottgens B. Cancer - Interactions investigated in the context of cancer Author confirms that ERG and LMO2 constructs are of human origin whereas the FLI1 construct is murine. bg200@cam.ac.uk Oncogene (0950-9232) 2010 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rbtn2_human Rhombotin-2 LMO2 RBTN2 RHOM2 TTG2 LIM domain only protein 2 Cysteine-rich protein TTG-2 T-cell translocation protein 2 RBTNL1 protein protein human Homo sapiens Human MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI erg_human Transcriptional regulator ERG ERG Transforming protein ERG protein protein human Homo sapiens Human MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY fli1_mouse Friend leukemia integration 1 transcription factor Retroviral integration site protein Fli-1 Fli1 Fli-1 protein protein mouse Mus musculus Mouse MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCNKLVGGGEANPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQWLEWAIKEYGLMEIDTSFFQNMDGKELCKMNKEDFLRATSAYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLNVKEDPSYDSVRRGAWNNNMNSGLNKSPLLGGSQTMGKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTETSMYKYPSDISYMPSYHAHQQKVNFVPSHPSSMPVTSSSFFGAASQYWTSPTAGIYPNPSVPRHPNTHVPSHLGSYY lmo2-erg 1007151 n/a 1007153 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1007154 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7d lmo2-fli1 1007152 n/a 1007155 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1007153 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7d