DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ huang-2009b-1 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. competition binding competition binding sequence tag sequence tag identification sequence tag Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-5 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. in vitro In vitro enzymatic study enzymatic study ms participant Identification by mass spectrometry ms participant Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. The proteins used have been confirmed as being Human ibn origin, by the authors. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-4 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. in vitro In vitro enzymatic study enzymatic study tag fluorescence tag visualisation by fluorescence tag fluorescence Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. The proteins used have been confirmed as being Human in origin, by the authors. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-3 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. The recombinant proteins used have been confirmed to be human by the authors. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-2 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. competition binding competition binding western blot western blot Immuno blot Immuno blot Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis The addition of increasing amounts of LDW643 does not block binding. LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. TNKS has not been entered as the authors state that both TNKS1 and TNKS2 were used. The authors confirm that 293 cells were used. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-6 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-7 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-8 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions huang-2009b-9 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Nature (0028-0836) 2009 imex curation Cancer - Interactions investigated in the context of cancer Only protein-protein interactions xav939 XAV939 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) chebi details to be added when available Chemical Name: 3,5,7,8-Tetrahydro-2-[4-(trifluorom ethyl)phenyl]-4H-thiopyrano[4,3-d]pyrimidin-4-one gmds_human GDP-mannose 4,6 dehydratase GDP-D-mannose dehydratase GMDS protein protein human Homo sapiens Human MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVHADVELMRTNPNA tnks2_human Poly [ADP-ribose] polymerase tankyrase-2 TNKS2 PARP5B TANK2 TNKL Poly [ADP-ribose] polymerase 5B TNKS-2 TRF1-interacting ankyrin-related ADP-ribose polymerase 2 Tankyrase II Tankyrase-like protein Tankyrase-related protein ADP-ribosyltransferase diphtheria toxin-like 6 Protein poly-ADP-ribosyltransferase tankyrase-2 Tankyrase-2 protein protein human Homo sapiens Human MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKHPQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVVKHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQLLQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASSLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG rfa3_human Replication protein A 14 kDa subunit Replication factor A protein 3 RPA3 REPA3 RPA14 protein protein human Homo sapiens Human MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD sp16h_human FACT complex subunit SPT16 Facilitates chromatin transcription complex subunit SPT16 FACT 140 kDa subunit FACTp140 Chromatin-specific transcription elongation factor 140 kDa subunit SUPT16H FACT140 FACTP140 protein protein human Homo sapiens Human MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK h2aj_human Histone H2A.J H2AJ H2AFJ protein protein human Homo sapiens Human MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK ssrp1_human FACT complex subunit SSRP1 SSRP1 FACT80 Facilitates chromatin transcription complex subunit SSRP1 Facilitates chromatin transcription complex 80 kDa subunit Chromatin-specific transcription elongation factor 80 kDa subunit Structure-specific recognition protein 1 Recombination signal sequence recognition protein 1 T160 protein protein human Homo sapiens Human MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNAKKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEEDVAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSSEDSASGSDE h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG baf_human Barrier-to-autointegration factor BANF1 BAF BCRG1 Breakpoint cluster region protein 1 protein protein human Homo sapiens Human MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL h32_human Histone H3.2 H3C13 H3C14 H3C15 H3-clustered histone 13 H3-clustered histone 14 H3-clustered histone 15 H3F2 H3FM HIST2H3A HIST2H3C HIST2H3D Histone H3/m Histone H3/o protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW parp2_human Poly [ADP-ribose] polymerase 2 PARP2 ADPRT2 ADPRTL2 NAD(+) ADP-ribosyltransferase 2 Poly[ADP-ribose] synthase 2 ADP-ribosyltransferase diphtheria toxin-like 2 DNA ADP-ribosyltransferase PARP2 Protein poly-ADP-ribosyltransferase PARP2 protein protein human Homo sapiens Human MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKDRTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE rfa1_human Replication protein A 70 kDa DNA-binding subunit Replication factor A protein 1 Single-stranded DNA-binding protein RPA1 REPA1 RPA70 protein protein human Homo sapiens Human MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM tnks1_human Poly [ADP-ribose] polymerase tankyrase-1 TNKS PARP5A PARPL TIN1 TINF1 TNKS1 Tankyrase I TNKS-1 TRF1-interacting ankyrin-related ADP-ribose polymerase Poly [ADP-ribose] polymerase 5A ADP-ribosyltransferase diphtheria toxin-like 5 Protein poly-ADP-ribosyltransferase tankyrase-1 Tankyrase-1 protein protein human Homo sapiens Human MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT znrd2_human Protein ZNRD2 ZNRD2 Autoantigen p27 SSSCA1 Sjoegren syndrome/scleroderma autoantigen 1 Zinc ribbon domain-containing protein 2 protein protein human Homo sapiens Human MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH emd_human Emerin EDMD STA EMD protein protein human Homo sapiens Human MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF nad+ nicotinamide adenine dinucleotide - oxidised form small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) veliparib/abt-888 ABT-888 -VELIPARIB small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) iwr-1-endo IWR-1-endo small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) iwr-1-exo IWR-1-exo small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) axin1_mouse Axin-1 Axin1 Axin Fu Axis inhibition protein 1 Protein Fused protein protein mouse Mus musculus Mouse MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESIQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARRVQSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFGGKTSAPSKRNTKKAESGKNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGLRKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQRYVQAVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD axin2_human Axin-2 AXIN2 Axin-like protein Axis inhibition protein 2 Conductin protein protein human Homo sapiens Human MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDSEISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPKEMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST ldw639-xav939-14 1181651 n/a 1181660 unspecified role unspecified role bait bait n/a 1181661 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ldw639-xav939-12 1181651 n/a 1181660 unspecified role unspecified role bait bait n/a 1181662 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ldw639-xav939-13 1181651 n/a 1181663 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-3 1181651 n/a 1181664 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-2 1181651 n/a 1181665 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-15 1181651 n/a 1181660 unspecified role unspecified role bait bait n/a 1181666 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ldw639-xav939-4 1181651 n/a 1181660 competitor competitor competitor bait bait n/a 1181667 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ldw639-xav939-16 1181651 n/a 1181660 unspecified role unspecified role bait bait n/a 1181668 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ldw639-xav939-5 1181651 n/a 1181660 unspecified role unspecified role bait bait n/a 1181669 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ldw639-xav939-6 1181651 n/a 1181670 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-7 1181651 n/a 1181671 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-8 1181651 n/a 1181672 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-17 1181651 n/a 1181673 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-9 1181651 n/a 1181674 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-18 1181651 n/a 1181675 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-10 1181651 n/a 1181676 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2A ldw639-xav939-11 1181651 n/a 1181660 unspecified role unspecified role bait bait n/a 1181677 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ldw639-xav939-19 1181651 n/a 1181660 unspecified role unspecified role bait bait n/a 1181678 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A nad-tnks2 1181652 n/a 1181662 putative self putative self putative self putative self n/a 1181660 inhibitor inhibitor neutral component neutral component n/a 1181679 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 abt_888-nad_ 1181652 n/a 1181679 electron acceptor electron acceptor neutral component neutral component n/a 1181676 putative self putative self putative self putative self n/a 1181680 inhibitor inhibitor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 nad_-parp2 1181652 n/a 1181672 putative self putative self putative self putative self n/a 1181660 inhibitor inhibitor neutral component neutral component n/a 1181679 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of PARP2 nad_-parp1 1181652 n/a 1181679 electron acceptor electron acceptor neutral component neutral component n/a 1181671 putative self putative self putative self putative self n/a 1181660 inhibitor inhibitor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of PARP1 abt_888-tnks2 1181652 n/a 1181680 inhibitor inhibitor neutral component neutral component n/a 1181679 electron acceptor electron acceptor neutral component neutral component n/a 1181662 putative self putative self putative self putative self adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 nad_-tnks-2 1181652 n/a 1181676 putative self putative self putative self putative self n/a 1181660 inhibitor inhibitor neutral component neutral component n/a 1181679 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS1 abt_888-nad_-1 1181652 n/a 1181679 electron acceptor electron acceptor neutral component neutral component n/a 1181671 putative self putative self putative self putative self n/a 1181680 inhibitor inhibitor unspecified role unspecified role adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of PARP1 abt_888-nad_-2 1181652 n/a 1181680 inhibitor inhibitor unspecified role unspecified role n/a 1181679 electron acceptor electron acceptor neutral component neutral component n/a 1181672 putative self putative self putative self putative self adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of PARP2 iwr_1_endo-nad_ 1181652 n/a 1181681 inhibitor inhibitor neutral component neutral component n/a 1181679 electron acceptor electron acceptor neutral component neutral component n/a 1181676 putative self putative self putative self putative self adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS1 iwr_1_endo-nad_-1 1181652 n/a 1181681 inhibitor inhibitor neutral component neutral component n/a 1181662 putative self putative self putative self putative self n/a 1181679 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 iwr_1_exo-nad_ 1181652 n/a 1181682 inhibitor inhibitor neutral component neutral component n/a 1181662 putative self putative self putative self putative self n/a 1181679 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 iwr_1_exo-nad_-1 1181652 n/a 1181679 electron acceptor electron acceptor neutral component neutral component n/a 1181676 putative self putative self putative self putative self n/a 1181682 inhibitor inhibitor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181652 Fig 3I. Auto-poly-ADP-ribosylation of TNKS1 nad_tnks2 1181653 n/a 1181679 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1181660 inhibitor inhibitor neutral component neutral component n/a 1181662 putative self putative self putative self putative self sam+parp_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false adp ribosylation adp ribosylation reaction adp ribosylation false false false 1181653 Fig 3H, 5C. Auto-poly ADP ribosylation of TNKS2 axin1-nad_-2 1181653 n/a 1181660 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1181679 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1181662 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1181683 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) adp ribosylation adp ribosylation reaction adp ribosylation false false false Fig 5C Poly ADP ribosylation of Axin-1. nad_-tnks2 1181653 n/a 1181662 putative self putative self putative self putative self n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1181679 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1181660 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) adp ribosylation adp ribosylation reaction adp ribosylation false false false Fig S3i Auto-poly ADP ribosylation of TNKS2. IWR-1-endo and XAV939 inhibit the auto-poly ADP ribosylation of TNKS2. iwr_1_endo-nad_-3 1181653 n/a 1181681 inhibitor inhibitor neutral component neutral component n/a 1181679 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1181662 putative self putative self putative self putative self n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false adp ribosylation adp ribosylation reaction adp ribosylation false false false Fig S3i Auto-poly-adp ribosylation of TNKS2. IWR-1-endo and XAV939 inhibit the auto-poly ADP ribosylation of TNKS2. tnks-xav939 1181654 n/a 1181676 unspecified role unspecified role neutral component neutral component parp_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1181660 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1181654 Fig 2c tnks2-xav939 1181654 n/a 1181660 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1181662 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false parp_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false direct interaction direct interaction false false false 1181654 Fig 2c parp1-xav939-1 1181654 n/a 1181660 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1181671 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1181654 Fig 2c papr1-xav939 1181655 n/a 1181671 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2B parp2-xav939-20 1181655 n/a 1181672 unspecified role unspecified role prey prey n/a 1181660 unspecified role unspecified role bait bait physical association physical association false false false Fig 2B axin2-tnks 1181656 n/a 1181662 unspecified role unspecified role prey prey n/a 1181676 unspecified role unspecified role prey prey n/a 1181684 unspecified role unspecified role bait bait association association false false false Fig 4A axin1-gsk3b-2 1181656 n/a 1181685 unspecified role unspecified role bait bait n/a 1181686 unspecified role unspecified role prey prey physical association physical association false false false S1B XAV939 axin1-tnks-3 1181657 n/a 1181676 unspecified role unspecified role prey prey n/a 1181683 unspecified role unspecified role bait bait tbd_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 4B axin1-tnks-2 1181657 n/a 1181683 unspecified role unspecified role bait bait n/a 1181676 unspecified role unspecified role prey prey ankyrin_rpt_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supplementary Fig. 6a. axin1-tnks-1 1181658 n/a 1181676 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1181683 unspecified role unspecified role bait bait tbd_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 4D tnks-axin1-1 1181659 n/a 1181683 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tbd_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1181676 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4D