IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2009c-1 Increased radioresistance and accelerated B cell lymphomas in mice with Mdmx mutations that prevent modifications by DNA-damage-activated kinases. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang YV., Leblanc M., Wade M., Jochemsen AG., Wahl GM. Apoptosis - Interactions involving proteins with a function related to apoptosis NCS (neocarzinostatin, a radiomimetic agent) and proteosome inhibitor MG132. Additional detail of constructs supplied by the author. wahl@salk.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 2 imex curation Cancer - Interactions investigated in the context of cancer wang-2009c-2 Increased radioresistance and accelerated B cell lymphomas in mice with Mdmx mutations that prevent modifications by DNA-damage-activated kinases. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang YV., Leblanc M., Wade M., Jochemsen AG., Wahl GM. Apoptosis - Interactions involving proteins with a function related to apoptosis NCS (neocarzinostatin, a radiomimetic agent) and proteosome inhibitor MG132. Additional detail of constructs supplied by the author. wahl@salk.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 2 imex curation Cancer - Interactions investigated in the context of cancer 1433e_rat 14-3-3 protein epsilon Ywhae Mitochondrial import stimulation factor L subunit protein protein rat Rattus norvegicus (Rat) Rat MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ mdm4_mouse Protein Mdm4 Mdm4 Mdmx p53-binding protein Mdm4 Mdm2-like p53-binding protein Protein Mdmx Double minute 4 protein protein protein mouse Mus musculus Mouse MTSHSTSAQCSASDSACRISSEQISQVRPKLQLLKILHAAGAQGEVFTMKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGDLLGCQSFSVKDPSPLYDMLRKNLVTSASINTDAAQTLALAQDHTMDFPSQDRLKHGATEYSNPRKRTEEEDTHTLPTSRHKCRDSRADEDLIEHLSQDETSRLDLDFEEWDVAGLPWWFLGNLRNNCIPKSNGSTDLQTNQDIGTAIVSDTTDDLWFLNETVSEQLGVGIKVEAANSEQTSEVGKTSNKKTVEVGKDDDLEDSRSLSDDTDVELTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSNITAIPEKKDNEGIDVPDCRRTISAPVVRPKDGYLKEEKPRFDPCNSVGFLDLAHSSESQEIISSAREQTDIFSEQKAETESMEDFQNVLKPCSLCEKRPRDGNIIHGKTSHLTTCFHCARRLKKSGASCPACKKEIQLVIKVFIA mdm2_mouse E3 ubiquitin-protein ligase Mdm2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein Mdm2 RING-type E3 ubiquitin transferase Mdm2 protein protein mouse Mus musculus Mouse MCNTNMSVSTEGAASTSQIPASEQETLVRPKPLLLKLLKSVGAQNDTYTMKEIIFYIGQYIMTKRLYDEKQQHIVYCSNDLLGDVFGVPSFSVKEHRKIYAMIYRNLVAVSQQDSGTSLSESRRQPEGGSDLKDPLQAPPEEKPSSSDLISRLSTSSRRRSISETEENTDELPGERHRKRRRSLSFDPSLGLCELREMCSGGSSSSSSSSSESTETPSHQDLDDGVSEHSGDCLDQDSVSDQFSVEFEVESLDSEDYSLSDEGHELSDEDDEVYRVTVYQTGESDTDSFEGDPEISLADYWKCTSCNEMNPPLPSHCKRCWTLRENWLPDDKGKDKVEISEKAKLENSAQAEEGLDVPDGKKLTENDAKEPCAEEDSEEKAEQTPLSQESDDYSQPSTSSSIVYSSQESVKELKEETQDKDESVESSFSLNAIEPCVICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMIVLTYFN p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD mdm4-ywhae 884334 n/a 884336 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false escherichia coli dh5[alpha] escherichia coli dh5[alpha] n/a 884337 unspecified role unspecified role prey prey mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. n/a 884337 unspecified role unspecified role prey prey O35618:p.[Ser341Ala;Ser367Ala;Ser402Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false MdmxWT bound to 14-3-3 when cells were treated with NCS. In the absence of NCS, a small portion of MdmxWT was also pulled down. Three highly conserved serine residues are targeted by the DNA-damage-activated kinases, but no interaction was detected with Mdmx3SA cells, which contain mutations at these conserved serine residues. Fig 3A. mdm4-mdm2 884335 n/a 884337 unspecified role unspecified role bait bait n/a 884338 unspecified role unspecified role prey prey n/a 884339 unspecified role unspecified role prey prey physical association physical association false false false Three highly conserved serine residues are targeted by the DNA-damage-activated kinases. Similar amounts of Mdm2 were coimmunoprecipitated with MdmxWT and Mdmx3SA following DNA damage. Mdm2 was also coimmunoprecipitated with Mdmx3SA following treatment with the topoisomerase I inhibitor etoposide. Fig 3B, S4.