IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ miyako-2009-1 PAPA-1 Is a nuclear binding partner of IGFBP-2 and modulates its growth-promoting actions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Miyako K., Cobb LJ., Francis M., Huang A., Peng B., Pintar JE., Ariga H., Cohen P. Cancer - Interactions investigated in the context of cancer hassy@mednet.ucla.edu Human prostate Matchmaker cDNA library Mol. Endocrinol. (0888-8809) 2009 Only protein-protein interactions imex curation miyako-2009-2 PAPA-1 Is a nuclear binding partner of IGFBP-2 and modulates its growth-promoting actions. in vitro In vitro pull down pull down antibody detection identification by antibody antibody detection Miyako K., Cobb LJ., Francis M., Huang A., Peng B., Pintar JE., Ariga H., Cohen P. Cancer - Interactions investigated in the context of cancer Recombinant human IGFBP-2 used in this expt. was obtained from GroPep, vendor does not identify species for the expression system, given as 'mammalian'. hassy@mednet.ucla.edu Human prostate Matchmaker cDNA library Mol. Endocrinol. (0888-8809) 2009 Only protein-protein interactions imex curation miyako-2009-3 PAPA-1 Is a nuclear binding partner of IGFBP-2 and modulates its growth-promoting actions. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Miyako K., Cobb LJ., Francis M., Huang A., Peng B., Pintar JE., Ariga H., Cohen P. Cancer - Interactions investigated in the context of cancer hassy@mednet.ucla.edu Human prostate Matchmaker cDNA library Mol. Endocrinol. (0888-8809) 2009 Only protein-protein interactions imex curation miyako-2009-4 PAPA-1 Is a nuclear binding partner of IGFBP-2 and modulates its growth-promoting actions. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma confocal microscopy confocal microscopy immunostaining immunostaining Miyako K., Cobb LJ., Francis M., Huang A., Peng B., Pintar JE., Ariga H., Cohen P. Cancer - Interactions investigated in the context of cancer hassy@mednet.ucla.edu Human prostate Matchmaker cDNA library Mol. Endocrinol. (0888-8809) 2009 Only protein-protein interactions imex curation ibp2_human Insulin-like growth factor-binding protein 2 BP2 IBP2 IGFBP2 protein protein human Homo sapiens Human MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ in80b_human INO80 complex subunit B PAP-1-associated protein 1 High mobility group AT-hook 1-like 4 INO80B HMGA1L4 PAPA1 ZNHIT4 Zinc finger HIT domain-containing protein 4 IES2 homolog protein protein human Homo sapiens Human MSKLWRRGSTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQGSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPGSPLLAT ibp2-in80b 865626 n/a 865630 unspecified role unspecified role bait bait mature peptide sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false n/a 865631 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false 865636 865634 physical association physical association false false false The IGFBP2 construct is described as the mature peptide so the signal sequence, as described in the UniProtKB entry, has been removed. ibp2-in80b-2 865627 n/a 865630 unspecified role unspecified role prey prey human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma n/a 865631 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1. ibp2-in80b-3 865628 n/a 865630 unspecified role unspecified role bait bait n/a 865631 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.2A ibp2-in80b-5 865629 n/a 865631 unspecified role unspecified role neutral component neutral component n/a 865630 unspecified role unspecified role neutral component neutral component human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma colocalization colocalization false false false Fig. 3.