IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ito-2008-1 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag immunost anti tag immunostaining anti tag immunost Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ito-2008-8 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ito-2008-3 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ito-2008-4 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. human-sw620 Human caucasian colon adenocarcinoma SW620 cells sw620 Human caucasian colon adenocarcinoma SW620 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ito-2008-6 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ito-2008-2 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Untagged prey proteins identified by anti-bait antibodies Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ito-2008-5 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. human-colon human colon colon anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ito-2008-7 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Cancer Cell (1535-6108) 2008 Only protein-protein interactions 22 imex curation ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL tf7l2_human Transcription factor 7-like 2 TCF7L2 TCF4 HMG box transcription factor 4 T-cell-specific transcription factor 4 protein protein human Homo sapiens Human MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE runx3_human Runt-related transcription factor 3 RUNX3 AML2 CBFA3 PEBP2A3 Core-binding factor subunit alpha-3 Acute myeloid leukemia 2 protein Oncogene AML-2 Polyomavirus enhancer-binding protein 2 alpha C subunit SL3-3 enhancer factor 1 alpha C subunit SL3/AKV core-binding factor alpha C subunit protein protein human Homo sapiens Human MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY tf7l1_mouse Transcription factor 7-like 1 HMG box transcription factor 3 Tcf7l1 Tcf3 protein protein mouse Mus musculus Mouse MPQLGGGRGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDTASAQRDLDEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGGAYPGYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAAPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHAQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQIQEAEGALASKSKKPCIQYLPPEKPCDSPASSHGSALDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARAQLALHSAAFLSAKAAASNSSQMGSQPPLLSRPLPLGSMPAALLTSPPTFPATLHAHQALPVLQAQPLSLVTKSAH tcf7_human Transcription factor 7 TCF7 TCF1 T-cell-specific transcription factor 1 protein protein human Homo sapiens Human MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSSSSSPA lef1_mouse Lymphoid enhancer-binding factor 1 Lef1 Lef-1 protein protein mouse Mus musculus Mouse MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPSSLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI ccnd1_human_gene Human Cyclin D1 gene gene gene human Homo sapiens Human myc_human_gene Human c-myc gene gene gene human Homo sapiens Human runx3-tcf7l2-1 Interaction between RUNX3, CTNNB1 and TCF7L2 identified by coimmunoprecipitation 780299 n/a 780307 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780308 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780309 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2B runx3-tcf7l2-2 Interaction between RUNX3, CTNBB1 and TCF7L2 identified by coimmunoprecipitation 780299 n/a 780308 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780307 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780309 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2B runx3-tcf7l2-3 Interaction between RUNX3, CTNNB1 and TCF7L2 identified by coimmunoprecipitation 780299 n/a 780309 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780307 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780308 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2B runx3-tcf7l2-14 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780299 n/a 780309 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false runt region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 780308 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. S2A runx3-tcf7l2-15 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780299 n/a 780308 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 780309 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. S2B runx3-tcf7l1-1 Interaction between RUNX3 and TCF7L1 (TCF3) identified by coimmunoprecipitation 780299 n/a 780310 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780309 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. S2C runx3-tcf7-1 Interaction between RUNX3 and TCF7 (TCF1) identified by coimmunoprecipitation 780299 n/a 780311 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780309 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. S2C runx3-lef1-1 Interaction between RUNX3 and LEF1 identified by coimmunoprecipitation 780299 n/a 780309 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780312 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. S2C tcf7l2-ccnd1_gene Binding of TCF7L2 to the CCND1 gene is inhibited by RUNX3 780300 n/a 780308 unspecified role unspecified role bait bait n/a 780309 competitor competitor competitor prey prey n/a 780313 unspecified role unspecified role prey prey association association false false false Q13761 transfection Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3C, 3D tcf7l2-myc_gene Binding of TCF7L2 to the MYC gene is inhibited by RUNX3 780300 n/a 780309 competitor competitor competitor prey prey n/a 780314 unspecified role unspecified role prey prey n/a 780308 unspecified role unspecified role bait bait association association false false false Q13761 transfection Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3C, 3D ctnnb1-myc_gene Binding of CTNNB1 to the MYC gene is inhibited by RUNX3 780300 n/a 780307 unspecified role unspecified role bait bait n/a 780309 competitor competitor competitor prey prey n/a 780314 unspecified role unspecified role prey prey association association false false false Q13761 transfection Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3D ctnnb1-ccnd1_gene Binding of CTNNB1 to the CCND1 gene is inhibited by RUNX3 780300 n/a 780313 unspecified role unspecified role prey prey n/a 780309 competitor competitor competitor prey prey n/a 780307 unspecified role unspecified role bait bait association association false false false Q13761 transfection Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3D runx3-tcf7l2-5 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780301 n/a 780307 unspecified role unspecified role bait bait n/a 780308 unspecified role unspecified role prey prey n/a 780309 unspecified role unspecified role prey prey association association false false false Fig. 2D runx3-tcf7l2-7 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780301 n/a 780308 unspecified role unspecified role prey prey n/a 780307 unspecified role unspecified role prey prey n/a 780309 unspecified role unspecified role bait bait association association false false false Fig. 2D runx3-tcf7l2-8 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780301 n/a 780309 unspecified role unspecified role prey prey n/a 780308 unspecified role unspecified role bait bait n/a 780307 unspecified role unspecified role prey prey association association false false false Fig. 2D runx3-tcf7l2-6 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780302 n/a 780309 unspecified role unspecified role prey prey n/a 780307 unspecified role unspecified role bait bait n/a 780308 unspecified role unspecified role prey prey association association false false false Fig. 2D runx3-tcf7l2-9 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780302 n/a 780309 unspecified role unspecified role bait bait n/a 780308 unspecified role unspecified role prey prey n/a 780307 unspecified role unspecified role prey prey association association false false false Fig. 2D runx3-tcf7l2-10 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780302 n/a 780307 unspecified role unspecified role prey prey n/a 780309 unspecified role unspecified role prey prey n/a 780308 unspecified role unspecified role bait bait association association false false false Fig. 2D runx3-tcf7l2-11 Interaction between RUNX3 and TCF7L2 identified by pulldown 780303 n/a 780307 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 780309 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 780308 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false Fig. 2E runx3-tcf7l2-12 Interaction between RUNX3 and TCF7L2 identified by pulldown 780303 n/a 780308 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 780309 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 2E runx3-ctnnb1-1 Interaction between RUNX3 and CTNNB1 identified by pulldown 780303 n/a 780307 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 780309 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 2E runx3-tcf7l2-4 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780304 n/a 780309 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780308 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780307 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2C, 2L runx3-tcf7l2-13 Interaction between RUNX3 and TCF7L2 identified by coimmunoprecipitation 780304 n/a 780307 unspecified role unspecified role prey prey n/a 780308 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 780309 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2I Complex first purified by anti-flag co-immunoprecipitation then formation of ternary complex confirmed by a second round of coimmunoprecipitation with anti-myc antibodies. ctnnb1-tcf7l2-9 Interaction between CTNNB1 and TCF7L2 identified by coimmunoprecipitation 780305 n/a 780308 unspecified role unspecified role prey prey n/a 780307 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2D SW480 cells appear to express very low levels of RUNX3 - RUNX3 does appear in the complex if blots are over-exposed. ctnnb1-tcf7l2-10 Interaction between CTNNB1 and TCF7L2 identified by coimmunoprecipitation 780305 n/a 780307 unspecified role unspecified role prey prey n/a 780308 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2D SW480 cells appear to express very low levels of RUNX3 - RUNX3 does appear in the complex if blots are over-exposed. runx3-ctnnb1-2 Interaction between RUNX3 and CTNNB1 identified by coimmunoprecipitation 780306 n/a 780307 unspecified role unspecified role prey prey undefined mutation mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P35222:p.Ser33Tyr mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 780309 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2F Oncogenic beta-catenins have a higher affinity for RUNX3 than wild-type beta-catenin.