IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ whitehurst-2008-1 The RASSF1A tumor suppressor restrains anaphase-promoting complex/cyclosome activity during the G1/S phase transition to promote cell cycle progression in human epithelial cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Whitehurst AW., Ram R., Shivakumar L., Gao B., Minna JD., White MA. Apoptosis - Interactions involving proteins with a function related to apoptosis michael.white@utsouthwestern.edu A HeLa cDNA library was used. Mol. Cell. Biol. (0270-7306) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer whitehurst-2008-2 The RASSF1A tumor suppressor restrains anaphase-promoting complex/cyclosome activity during the G1/S phase transition to promote cell cycle progression in human epithelial cells. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Whitehurst AW., Ram R., Shivakumar L., Gao B., Minna JD., White MA. Apoptosis - Interactions involving proteins with a function related to apoptosis michael.white@utsouthwestern.edu A HeLa cDNA library was used. Mol. Cell. Biol. (0270-7306) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer whitehurst-2008-3 The RASSF1A tumor suppressor restrains anaphase-promoting complex/cyclosome activity during the G1/S phase transition to promote cell cycle progression in human epithelial cells. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Whitehurst AW., Ram R., Shivakumar L., Gao B., Minna JD., White MA. Apoptosis - Interactions involving proteins with a function related to apoptosis michael.white@utsouthwestern.edu A HeLa cDNA library was used. Mol. Cell. Biol. (0270-7306) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer q9ns23-2 Ras association domain-containing protein 1 RASSF1A RASSF1 RDA32 protein protein human Homo sapiens Human MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG Produced by alternative splicing of isoform D. ews_human RNA-binding protein EWS EWSR1 EWS EWS oncogene Ewing sarcoma breakpoint region 1 protein protein protein human Homo sapiens Human MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY stk3_human Serine/threonine-protein kinase 3 STE20-like kinase MST2 Mammalian STE20-like protein kinase 2 Serine/threonine-protein kinase Krs-1 STK3 MST2 KRS1 protein protein human Homo sapiens Human MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF rassf1-ewsr1 RASSF1 interacts with EWSR1 (EWS) in a yeast two-hybrid assay 739828 n/a 739831 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 739832 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 739838 739836 physical association physical association false false false The isoform shown is as described in the publication however isoforms Q9NS23-5, Q9NS23-6 and Q9NS23-7 are identical in this region to Q9NS23-2. rassf1-ewsr1-1 RASSF1 coimmunoprecipitates EWSR1 (EWS) in HEK293 lysates 739829 n/a 739831 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 739832 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 B Q9NS23; Q01844 transfection Q01844 overexpressed The isoform shown is as described in the publication however isoforms Q9NS23-5, Q9NS23-6 and Q9NS23-7 are identical in the region against which the antibody was raised to Q9NS23-2. rassf1-ewsr1-2 RASSF1 coimmunoprecipitates EWSR1 (EWS) in HeLa lysates 739830 n/a 739831 unspecified role unspecified role bait bait N/A 739833 unspecified role unspecified role prey prey N/A 739832 unspecified role unspecified role prey prey association association false false false 1 C The isoform shown is as described in the publication however isoforms Q9NS23-5, Q9NS23-6 and Q9NS23-7 are identical in the region against which the antibopdy was raised to Q9NS23-2.