IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kang-2008-2 Tissue inhibitor of metalloproteinases-3 interacts with angiotensin II type 2 receptor and additively inhibits angiogenesis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kang KH., Park SY., Rho SB., Lee JH. Cancer - Interactions investigated in the context of cancer sbrho@ncc.re.kr,jeholee@gmail.com Cardiovasc. Res. (0008-6363) 2008 Only protein-protein interactions imex curation A human ovary cDNA library was used. kang-2008-5 Tissue inhibitor of metalloproteinases-3 interacts with angiotensin II type 2 receptor and additively inhibits angiogenesis. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kang KH., Park SY., Rho SB., Lee JH. Cancer - Interactions investigated in the context of cancer sbrho@ncc.re.kr,jeholee@gmail.com Cardiovasc. Res. (0008-6363) 2008 Only protein-protein interactions imex curation A human ovary cDNA library was used. kang-2008-1 Tissue inhibitor of metalloproteinases-3 interacts with angiotensin II type 2 receptor and additively inhibits angiogenesis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kang KH., Park SY., Rho SB., Lee JH. Cancer - Interactions investigated in the context of cancer sbrho@ncc.re.kr,jeholee@gmail.com A human ovary cDNA library was used. Cardiovasc. Res. (0008-6363) 2008 Only protein-protein interactions imex curation kang-2008-3 Tissue inhibitor of metalloproteinases-3 interacts with angiotensin II type 2 receptor and additively inhibits angiogenesis. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kang KH., Park SY., Rho SB., Lee JH. Cancer - Interactions investigated in the context of cancer sbrho@ncc.re.kr,jeholee@gmail.com Cardiovasc. Res. (0008-6363) 2008 Only protein-protein interactions imex curation A human ovary cDNA library was used. kang-2008-4 Tissue inhibitor of metalloproteinases-3 interacts with angiotensin II type 2 receptor and additively inhibits angiogenesis. human-skov_3 Homo sapiens ovarian adenocarcinoma cell line skov_3 Human ovarian adenocarcinoma cell line Derived from the ascitic fluid from a 64 year old caucasian female with an ovarian tumour. Forms moderately well-differentiated adenocarcinoma consistent with ovarian primary cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kang KH., Park SY., Rho SB., Lee JH. Cancer - Interactions investigated in the context of cancer sbrho@ncc.re.kr,jeholee@gmail.com Cardiovasc. Res. (0008-6363) 2008 Only protein-protein interactions imex curation A human ovary cDNA library was used. timp3_human Metalloproteinase inhibitor 3 TIMP3 Tissue inhibitor of metalloproteinases 3 Protein MIG-5 protein protein human Homo sapiens Human MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP agtr2_human Type-2 angiotensin II receptor AGTR2 Angiotensin II type-2 receptor protein protein human Homo sapiens Human MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMETFVS timp3-agtr2-3 TIMP-3 and AGTR2 interact in a directed yeast two-hybrid assay 729743 N/A 729748 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 729749 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 729754 729752 physical association physical association false false false S1 C PREY gene NM_000686 agtr2-timp3-1 TIMP-3 and AGTR2 interact in a directed yeast two-hybrid assay 729743 N/A 729749 unspecified role unspecified role bait bait N/A 729748 unspecified role unspecified role prey prey physical association physical association false false false 1 A BAIT gene NM_000686 agtr2-timp3 Endogenous AGTR2 coimmunoprecipitates endogenous TIMP-3 in HEK293 lysates 729744 N/A 729749 unspecified role unspecified role bait bait N/A 729748 unspecified role unspecified role prey prey physical association physical association false false false 1 E BAIT gene NM_000686 agtr2-timp3-2 Endogenous AGTR2 coimmunoprecipitates with endogenous TIMP-3 in HEK293 lysates 729744 N/A 729748 unspecified role unspecified role bait bait N/A 729749 unspecified role unspecified role prey prey physical association physical association false false false 1 E PREY gene NM_000686 timp3-agtr2 TIMP-3 and AGTR2 interact in a yeast two-hybrid assay 729745 N/A 729749 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 729748 unspecified role unspecified role bait bait physical association physical association false false false S1 A PREY gene NM_000686 timp3-agtr2-1 TIMP-3 coimmunoprecipitates AGTR2 in HEK293 lysates 729746 N/A 729749 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 729748 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S1 B PREY gene NM_000686 P50052; P35625 transfection timp3-agtr2-2 TIMP-3 coimmunoprecipitates AGTR2 in SKOV-3 lysates 729747 N/A 729749 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 729748 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 B PREY gene NM_000686 P50052; P35625 transfection